TkA03G334410 | RubberDandelionOmics

Gene overview

TkA03G334410

Reference: TK1151 Chr: Chr03 Coordinates: 82243151-82244051 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

745 bp · TkA03G334410|TK1151|cDNA

CAACTCTCTCTTCCACTCTCTTCTAAATAACCAACTCCGTAATTCAAATCAACCTTAAAAACAGTAATCTCCACTTAACGTAAACCACCAGTGATTACGTTCCTCCCAAAAACCCTTTACAGCCATGAAGAACACGATCACCATTTTCATGGCGGTAGCCTTCTTTTCCTCCATTCTCACAGTCCACACCCTCGAATTCCAAGTTGGCGGTGACAAAGGCTGGGTTATTCCCCACTCAAACGACACTGATCTCTACGACC...

CDS

Download CDS FASTA

513 bp · TkA03G334410|TK1151|CDS

ATGAAGAACACGATCACCATTTTCATGGCGGTAGCCTTCTTTTCCTCCATTCTCACAGTCCACACCCTCGAATTCCAAGTTGGCGGTGACAAAGGCTGGGTTATTCCCCACTCAAACGACACTGATCTCTACGACCAATGGGCTTCCAAGAACCGCTTTAACGTCAACGACACACTTCATTTTGCGTATAAGAAGGATTCGGTGTTGGTTGTGAGCAAAGAGGAGCATGCAAAGTGCAAGTCGTCGCACCCTATCTTTTT...

Protein

Download Protein FASTA

170 aa · TkA03G334410|TK1151|PROTEIN

MKNTITIFMAVAFFSSILTVHTLEFQVGGDKGWVIPHSNDTDLYDQWASKNRFNVNDTLHFAYKKDSVLVVSKEEHAKCKSSHPIFFSNNGDTTFEMDRSGYFYFISGVSGHCERGLKMIVKVLEHGNIAQSANQTATNSSESVSLKVDGTVCSQIVIIVGLISMLTVFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G334410`
TK1151 ID	TkA03G334410
OH-1004 ID	LXL04_008771
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G334410

Location Chr03:82243151-82244051 (+)

Description Similar to At4g27520: Early nodulin-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48940`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At3g18590`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At5g14345`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At1g79800`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At4g28365`	May act as a carbohydrate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008771 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0009055 electron transfer activity Molecular Function

KEGG gene cross-reference

ath:AT1G48940

ath:AT1G79800

ath:AT3G18590

ath:AT4G28365

ath:AT5G14345

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.627

Rank 1 · TkA03G334410 · TK1151

Endoplasmic reticulum0.119

Rank 2 · TkA03G334410 · TK1151

Extracellular0.098

Rank 3 · TkA03G334410 · TK1151

Cytoplasm0.095

Rank 4 · TkA03G334410 · TK1151

Lysosome / Vacuole0.079

Rank 5 · TkA03G334410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02298Cu_bind_like42-116 aa

PF17514DUF544251-75 aa

PF23509MSMEG_3727_PQQ-assoc89-134 aa

PF23509MSMEG_3727_PQQ-assoc120-158 aa

PF17514DUF5442123-133 aa

PF02298Cu_bind_like131-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G334410	`PF02298`	Cu_bind_like	42	116	1e-17	64.6
TkA03G334410	`PF17514`	DUF5442	51	75	0.23	12.4
TkA03G334410	`PF23509`	MSMEG_3727_PQQ-assoc	89	134	0.038	14.2
TkA03G334410	`PF23509`	MSMEG_3727_PQQ-assoc	120	158	0.038	14.2
TkA03G334410	`PF17514`	DUF5442	123	133	0.23	12.4
TkA03G334410	`PF02298`	Cu_bind_like	131	150	1e-17	64.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4PSZ8`	Arabidopsis thaliana	sp\|Q4PSZ8\|ENL06_ARATH Early nodulin-like protein 6	57.900%	Swiss-Prot	Medium
`Q9LII0`	Arabidopsis thaliana	sp\|Q9LII0\|ENL05_ARATH Early nodulin-like protein 5	55.800%	Swiss-Prot	High
`F4K6R7`	Arabidopsis thaliana	sp\|F4K6R7\|ENL21_ARATH Early nodulin-like protein 21	51.500%	Swiss-Prot	Medium
`Q9SQN9`	Arabidopsis thaliana	sp\|Q9SQN9\|ENL07_ARATH Early nodulin-like protein 7	47.500%	Swiss-Prot	Medium
`F4JL85`	Arabidopsis thaliana	sp\|F4JL85\|ENL03_ARATH Early nodulin-like protein 3	43.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card