TkA03G332630 | RubberDandelionOmics

Gene overview

TkA03G332630

Reference: TK1151 Chr: Chr03 Coordinates: 81794348-81797833 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2834 bp · TkA03G332630|TK1151|cDNA

CTAAAACCCCACATACGAGATCAGAATCGATCGCCCTCCCCACGTCACCCGTTTCTCTTTGATCGATTACATCCAGGCGCCTCTTTCTTCCCCTTTTGTTGCTGCCATTGATCGAAAACGAAAAAGGAAGGAAAAACGAGAGCGGTGCTAGTGGTTGATTTCGTCGACAATGGGGTGAGAGGGGGAAGGGTGGCATTAGGCTGGAAGAAAGGAGGAGCAGGAGGGGCGACTTTGGGGGCTAATCCAGGGCTGATTTTGTT...

CDS

Download CDS FASTA

1836 bp · TkA03G332630|TK1151|CDS

ATGAGTAGGTCACCTTCATTTACAGCCAGGACTGAATCCAATGTATATGTGGACCCAGAATCCATCAAGAAATGGATAGTTGCATTTTGCATAATCAGATTTGACCTAGAACAAGGTCAACTCATCGAAGAATGCTACCCACCTGGTTGTCTTACCCCTGAAGAAGAACTCGACATTGCTTTCAGTTCATTCCCTGATTCAGTATCCCAACACCATAACAGATCAAGCATCCATGACTCCATGTTCTTCTTCAGAACACA...

Protein

Download Protein FASTA

611 aa · TkA03G332630|TK1151|PROTEIN

MSRSPSFTARTESNVYVDPESIKKWIVAFCIIRFDLEQGQLIEECYPPGCLTPEEELDIAFSSFPDSVSQHHNRSSIHDSMFFFRTQRRGTFPNEKIPKKPNESKYLYGFVFNRQRHDERLKRGGEQKSVVILSQSPYSSLFKPLLQIMGPLYFDIGRKSIDYIAGSMSTWAAPLPGQLMELPIGNSTLKVNLPPVHSLSFNSDMAFEESASSMAPLLPTNQSIPHGLFHDSDIFGIFRGLLLQLWLLWELLLIGEPILI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G332630`
TK1151 ID	TkA03G332630
OH-1004 ID	LXL04_008787
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 99.836 / OH-1004 99.836 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G332630`
Location	Chr03:81794348-81797833 (-)
Description	Similar to DENND6A: Protein DENND6A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008787` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:2000049 positive regulation of cell-cell adhesion mediated by cadherin Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0055037 recycling endosome Cellular Component GO:0005085 guanyl-nucleotide exchange factor activity Molecular Function
KEGG gene cross-reference	ddi:DDB_G0280481 hsa:201627 hsa:414918 mmu:211922 mmu:69440 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.624

Rank 1 · TkA03G332630 · TK1151

Golgi apparatus0.251

Rank 2 · TkA03G332630 · TK1151

Nucleus0.170

Rank 3 · TkA03G332630 · TK1151

Lysosome / Vacuole0.148

Rank 4 · TkA03G332630 · TK1151

Cell membrane0.141

Rank 5 · TkA03G332630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09794Avl926-155 aa

PF08616SPA243-323 aa

PF09794Avl9247-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G332630	`PF09794`	Avl9	26	155	4.1e-05	23.1
TkA03G332630	`PF08616`	SPA	243	323	0.016	15.9
TkA03G332630	`PF09794`	Avl9	247	283	4.1e-05	23.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card