TkA03G331680 | RubberDandelionOmics

Gene overview

TkA03G331680

Reference: TK1151 Chr: Chr03 Coordinates: 81532572-81534425 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1768 bp · TkA03G331680|TK1151|cDNA

TTAAACTTGGGTCAAAAGGTTTTCAACTCAACACGATTTATTTTTATAAATTAAAAAACTACCGAACCGCACTGCACCGATTAGTTTGTTTATTGGAAAAAAACGCATTTAGGGTTTGTGGTTCGGTTTCGACCTATAACTGCACCACAAAACAACACTAGGTTCACCTGTAGAATTTTCACTAGAGTCTTATCTTCGATCCTTCTATAGTCTATAAAAGAAAGACTACCCGTGGAAGTCCATCTAAACATCTCAAGAAT...

CDS

Download CDS FASTA

1497 bp · TkA03G331680|TK1151|CDS

ATGGCTCTGCATTTACTATTTCTTCTTCTGTCTCCTCTCCTCTACCTTCTTTTCAGAATCACCAAAAACAGATCTAGATTTAGTCCACCGGGCCCTGTTGGACTACCCTTCATCGGAAACTTGCACCACATCCATCGCTCAAGCCTCCACACTTCCCTATGGCAGCTATCCAAATCCTATGGTCCATTTGTATCTCTCAACATGGGTTTCATCCCAGTTATCGTTGTTTCCTCAGCCAGTCTAGCGAAAGAAGTCTTGAA...

Protein

Download Protein FASTA

498 aa · TkA03G331680|TK1151|PROTEIN

MALHLLFLLLSPLLYLLFRITKNRSRFSPPGPVGLPFIGNLHHIHRSSLHTSLWQLSKSYGPFVSLNMGFIPVIVVSSASLAKEVLKTQDINFCRRPSFVGTNKLSYNDSDVAFSPNNEYRREMKKIFMLHLLGPKKVESYRYIREDEVSSAMDKIHELTLSSKPVNLSELIKSVANNVLMRVAFGKSYQDAHKRKEIIQLLPEVQAILAELFVSDLWHGLPFVGLVDKLLGNMARVEKCFKYFDVLYQQLIDEHVNSQN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G331680`
TK1151 ID	TkA03G331680
OH-1004 ID	LXL04_008800
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	76.700
Protein coverage (%)	TK1151 99.398 / OH-1004 99.398 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G331680

Location Chr03:81532572-81534425 (-)

Description Similar to CYP83B1: Cytochrome P450 83B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31500`	Involved in the metabolism of aromatic oximes.	The SUR2 gene of Arabidopsis thaliana encodes the cytochrome P450 CYP83B1, a modulator of auxin homeostasis.2000 · DOI: 10.1073/pnas.260502697 CYP83B1, a cytochrome P450 at the metabolic branch point in auxin and indole glucosinolate biosynthesis in Arabidopsis.2001 · DOI: 10.1105/tpc.13.1.101 CYP83b1 is the oxime-metabolizing enzyme in the glucosinolate pathway in Arabidopsis.2001 · DOI: 10.1074/jbc.m102637200 The involvement of two p450 enzymes, CYP83B1 and CYP83A1, in auxin homeostasis and glucosinolate biosynthesis.2001 · DOI: 10.1104/pp.127.1.108 Arabidopsis cytochrome P450 cyp83B1 mutations activate the tryptophan biosynthetic pathway.2002 · DOI: 10.1093/genetics/160.1.323 CYP83A1 and CYP83B1, two nonredundant cytochrome P450 enzymes metabolizing oximes in the biosynthesis of glucosinolates in Arabidopsis.2003 · DOI: 10.1104/pp.102.019240 The bifurcation of the cyanogenic glucoside and glucosinolate biosynthetic pathways.2015 · DOI: 10.1111/tpj.13023

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008800 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0009625 response to insect Biological Process

GO:0009641 shade avoidance Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009684 indoleacetic acid biosynthetic process Biological Process

GO:0009759 indole glucosinolate biosynthetic process Biological Process

GO:0009805 coumarin biosynthetic process Biological Process

GO:0010114 response to red light Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048830 adventitious root development Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ag:AXB38860

ag:AXB38861

ag:AXB38863

ath:AT4G31500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.934

Rank 1 · TkA03G331680 · TK1151

Cytoplasm0.038

Rank 2 · TkA03G331680 · TK1151

Cell membrane0.035

Rank 3 · TkA03G331680 · TK1151

Plastid0.022

Rank 4 · TkA03G331680 · TK1151

Golgi apparatus0.021

Rank 5 · TkA03G331680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45029-488 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G331680	`PF00067`	p450	29	488	1.1e-105	354.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65782`	Arabidopsis thaliana	sp\|O65782\|C83B1_ARATH Cytochrome P450 83B1	46.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card