TkA03G329870 | RubberDandelionOmics

Gene overview

TkA03G329870

Reference: TK1151 Chr: Chr03 Coordinates: 81085179-81086678 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1413 bp · TkA03G329870|TK1151|cDNA

ATGCACATGCAACTACTTCCCAACAACCGGGTTGTCATGTACGACCGCACAGATTTTGGAGTCTCCAACATCTCACTTCCAGACGGCAAATGCCGCCCCAACACCACCGACTGCTCCGCCCATTCGGTTGAGTATGATATTGCATCAAACACCATACACGGTTATCGTGTTGTCCGAACTTACAAATCGTGTGATTCATGCGACTGGAAAGAGATACGTAATGGCCTGAATCAACAACGATGGTATGCGACCAATCATAT...

CDS

Download CDS FASTA

1413 bp · TkA03G329870|TK1151|CDS

ATGCACATGCAACTACTTCCCAACAACCGGGTTGTCATGTACGACCGCACAGATTTTGGAGTCTCCAACATCTCACTTCCAGACGGCAAATGCCGCCCCAACACCACCGACTGCTCCGCCCATTCGGTTGAGTATGATATTGCATCAAACACCATACACGGTTATCGTGTTGTCCGAACTTACAAATCGTGTGATTCATGCGACTGGAAAGAGATACGTAATGGCCTGAATCAACAACGATGGTATGCGACCAATCATAT...

Protein

Download Protein FASTA

470 aa · TkA03G329870|TK1151|PROTEIN

MHMQLLPNNRVVMYDRTDFGVSNISLPDGKCRPNTTDCSAHSVEYDIASNTIHGYRVVRTYKSCDSCDWKEIRNGLNQQRWYATNHILPDGKQIIIGGRRAFSYEFYPKMSANENTPSLPFLVETNDPNVENNLYPFVFLYPDGNLFIFANNRAILFDYSRNQVIKTYPTMPGGQPRSYPSTGSAVLLPLRITQGAVNVVEVLVCGGAPKGAFVNANKGIFDGALDTCGRIKISDPNPQWVMETMPLARVMGDMLLLPNG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G329870`
TK1151 ID	TkA03G329870
OH-1004 ID	LXL04_008813
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.000
Protein coverage (%)	TK1151 100.000 / OH-1004 91.560 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G329870

Location Chr03:81085179-81086678 (+)

Description Similar to GLOX: Aldehyde oxidase GLOX

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67290`	Catalyzes the oxidation of aldehydes to the corresponding carboxylate by coupling the reaction to the reduction of dioxygen to hydrogen peroxide.	The MYB80 transcription factor is required for pollen development and the regulation of tapetal programmed cell death in Arabidopsis thaliana.2011 · DOI: 10.1105/tpc.110.082651

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008813 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0050665 hydrogen peroxide biosynthetic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004031 aldehyde oxidase activity Molecular Function

KEGG gene cross-reference

abe:ARB_07867

ag:AAA33747

ath:AT1G67290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.871

Rank 1 · TkA03G329870 · TK1151

Cytoplasm0.061

Rank 2 · TkA03G329870 · TK1151

Cell membrane0.036

Rank 3 · TkA03G329870 · TK1151

Lysosome / Vacuole0.025

Rank 4 · TkA03G329870 · TK1151

Endoplasmic reticulum0.024

Rank 5 · TkA03G329870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07250Glyoxal_oxid_N1-55 aa

PF07250Glyoxal_oxid_N53-353 aa

PF07646Kelch_281-99 aa

PF07646Kelch_2134-152 aa

PF07646Kelch_2203-208 aa

PF07646Kelch_2313-338 aa

PF09118GO-like_E_set362-469 aa

PF07646Kelch_2386-409 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G329870	`PF07250`	Glyoxal_oxid_N	1	55	7.8e-161	535.8
TkA03G329870	`PF07250`	Glyoxal_oxid_N	53	353	7.8e-161	535.8
TkA03G329870	`PF07646`	Kelch_2	81	99	0.024	15.3
TkA03G329870	`PF07646`	Kelch_2	134	152	0.024	15.3
TkA03G329870	`PF07646`	Kelch_2	203	208	0.024	15.3
TkA03G329870	`PF07646`	Kelch_2	313	338	0.024	15.3
TkA03G329870	`PF09118`	GO-like_E_set	362	469	5.6e-25	88.3
TkA03G329870	`PF07646`	Kelch_2	386	409	0.024	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYG4`	Arabidopsis thaliana	sp\|Q9FYG4\|GLOX1_ARATH Aldehyde oxidase GLOX1	42.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card