TkA03G324360 | RubberDandelionOmics

Gene overview

TkA03G324360

Reference: TK1151 Chr: Chr03 Coordinates: 79711398-79712006 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · TkA03G324360|TK1151|cDNA

ATGGCCATAGAGTGGAATTTAATCGAAGAAGAAGGATGCCTCCATCGTTTCTACAAAATTGTTCTCGGTTGGGACTACCTCCGCCTCCTCAAAGAATCCTCCAAAAAGAACAAAAACACTCCTAATGCAAAGGATTTGGGTATGAAGCAAGTAAAGGACACGTATAAAGATGTATATGATTACCTTGCCACATTTGAGCCTCTCTTATTTGAAGAAGTTAAAGCTCAAATCGTACAAGGCAAAGATGAGGAAGAAGCTGT...

CDS

Download CDS FASTA

336 bp · TkA03G324360|TK1151|CDS

ATGGCCATAGAGTGGAATTTAATCGAAGAAGAAGGATGCCTCCATCGTTTCTACAAAATTGTTCTCGGTTGGGACTACCTCCGCCTCCTCAAAGAATCCTCCAAAAAGAACAAAAACACTCCTAATGCAAAGGATTTGGGTATGAAGCAAGTAAAGGACACGTATAAAGATGTATATGATTACCTTGCCACATTTGAGCCTCTCTTATTTGAAGAAGTTAAAGCTCAAATCGTACAAGGCAAAGATGAGGAAGAAGCTGT...

Protein

Download Protein FASTA

111 aa · TkA03G324360|TK1151|PROTEIN

MAIEWNLIEEEGCLHRFYKIVLGWDYLRLLKESSKKNKNTPNAKDLGMKQVKDTYKDVYDYLATFEPLLFEEVKAQIVQGKDEEEAVCGPTDAWTLAVFQCPDSRLQPAFA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G324360`
TK1151 ID	TkA03G324360
OH-1004 ID	LXL04_008836
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G324360

Location Chr03:79711398-79712006 (+)

Description Similar to MAA3: Probable helicase MAGATAMA 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15570`	Probable helicase that may regulate RNA molecules involved in nucleolar organization and pollen tube guidance.	Attractive and repulsive interactions between female and male gametophytes in Arabidopsis pollen tube guidance.2000 · DOI: 10.1242/dev.127.20.4511 MAA3 (MAGATAMA3) helicase gene is required for female gametophyte development and pollen tube guidance in Arabidopsis thaliana.2008 · DOI: 10.1093/pcp/pcn130

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008836 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006369 termination of RNA polymerase II transcription Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009875 pollen-pistil interaction Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0005634 nucleus Cellular Component

GO:0005694 chromosome Cellular Component

GO:0016604 nuclear body Cellular Component

GO:0001147 transcription termination site sequence-specific DNA binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0004386 helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT4G15570

ddi:DDB_G0274399

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.412

Rank 1 · TkA03G324360 · TK1151

Nucleus0.311

Rank 2 · TkA03G324360 · TK1151

Mitochondrion0.196

Rank 3 · TkA03G324360 · TK1151

Extracellular0.141

Rank 4 · TkA03G324360 · TK1151

Cell membrane0.086

Rank 5 · TkA03G324360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B6SFA4`	Arabidopsis thaliana	sp\|B6SFA4\|MAA3_ARATH Probable helicase MAGATAMA 3	56.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card