TkA03G319250 | RubberDandelionOmics

Gene overview

TkA03G319250

Reference: TK1151 Chr: Chr03 Coordinates: 78323852-78325586 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1307 bp · TkA03G319250|TK1151|cDNA

ATATCATGCAAGAATGCATCTTGAAATAGTCATAGCAACCTATTAGTGGCAATCACCCATCTAATCTTGGAGGGTTTGGAAACACTTTTAGCTCATCAATGGCAGCTTCTCTTCTCTACACTACGTTTACAGTAATGGCAGCTATCCTCTCATCCTCCATTGTTTGCTTGGCTTTTCCAGGGTTCAGCTTCGGATGGGGTAGTGGTGGGCCAGGGGCTGGTGGAGGTGGTGAAGGTGACGGTGGTGGTAATTTTGGCAAT...

CDS

Download CDS FASTA

1089 bp · TkA03G319250|TK1151|CDS

ATGGCAGCTTCTCTTCTCTACACTACGTTTACAGTAATGGCAGCTATCCTCTCATCCTCCATTGTTTGCTTGGCTTTTCCAGGGTTCAGCTTCGGATGGGGTAGTGGTGGGCCAGGGGCTGGTGGAGGTGGTGAAGGTGACGGTGGTGGTAATTTTGGCAATGGGCAAGGGTATCTTGGTCTTTTCCCTGAATTCTATAGTTTCTCATGTCCTCAAGCTAATGACATTGTCATGTCTGTTCTTGAGAGTGTCATTGCAAA...

Protein

Download Protein FASTA

362 aa · TkA03G319250|TK1151|PROTEIN

MAASLLYTTFTVMAAILSSSIVCLAFPGFSFGWGSGGPGAGGGGEGDGGGNFGNGQGYLGLFPEFYSFSCPQANDIVMSVLESVIAKEPRMAASLLRLHFHDCFVQGCDASVLLDESAMFESEKNSVPNSNSIRGFEVIDEIKSKLEESCPQTVSCADILALAARASTVLSGGPNWELPLGRRDATQASLIASNNNLPPPNSTIQNLLTLFRRQGLDEVDLVSLSGAHTIGMARCGAFKQRLYNQDGNDQPDSTLEITYS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G319250`
TK1151 ID	TkA03G319250
OH-1004 ID	LXL04_008860
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G319250

Location Chr03:78323852-78325586 (-)

Description Similar to PER9: Peroxidase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g44970`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At4g36430`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At2g18150`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At5g66390`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At3g50990`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008860 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0048658 anther wall tapetum development Biological Process

GO:0051707 response to other organism Biological Process

GO:0080001 mucilage extrusion from seed coat Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0004601 peroxidase activity Molecular Function

GO:0020037 heme binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0140825 lactoperoxidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G44970

ath:AT2G18140

ath:AT2G18150

ath:AT4G36430

ath:AT5G66390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.424

Rank 1 · TkA03G319250 · TK1151

Extracellular0.182

Rank 2 · TkA03G319250 · TK1151

Cytoplasm0.140

Rank 3 · TkA03G319250 · TK1151

Endoplasmic reticulum0.103

Rank 4 · TkA03G319250 · TK1151

Cell membrane0.097

Rank 5 · TkA03G319250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00141peroxidase78-326 aa

PF16087DUF4817195-215 aa

PF16087DUF4817313-325 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G319250	`PF00141`	peroxidase	78	326	2.2e-81	273.8
TkA03G319250	`PF16087`	DUF4817	195	215	0.15	12.5
TkA03G319250	`PF16087`	DUF4817	313	325	0.15	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96512`	Arabidopsis thaliana	sp\|Q96512\|PER9_ARATH Peroxidase 9	67.600%	Swiss-Prot	High
`O23237`	Arabidopsis thaliana	sp\|O23237\|PER49_ARATH Peroxidase 49	62.300%	Swiss-Prot	High
`Q9SI16`	Arabidopsis thaliana	sp\|Q9SI16\|PER15_ARATH Peroxidase 15	61.300%	Swiss-Prot	High
`Q9FJZ9`	Arabidopsis thaliana	sp\|Q9FJZ9\|PER72_ARATH Peroxidase 72	60.800%	Swiss-Prot	High
`Q9SD46`	Arabidopsis thaliana	sp\|Q9SD46\|PER36_ARATH Peroxidase 36	58.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card