TkA03G298770 | RubberDandelionOmics

Gene overview

TkA03G298770

Reference: TK1151 Chr: Chr03 Coordinates: 73492676-73503240 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2443 bp · TkA03G298770|TK1151|cDNA

CTAACCTCTAACCTCTAATAGCAATTTTAAATAAATGAAAATATAAAAAGATTAATAAAAAACTCAAAGAGCATTTCCTCTTTGTTCACGTCTCCTAGTTTGATTGCCAGATCTTTCTATTCCTCCAAAAAGAATCAACTCTTCCATATTTTCTTAATTTTCATGCTCAGCTAAGAGATGATCAAACTCCAGAACTTCTTCATACTTTTAATATCTATTTTACCTTCTATTCAATCACAGAATCGCACAAACTGTGATCG...

CDS

Download CDS FASTA

2070 bp · TkA03G298770|TK1151|CDS

ATGATCAAACTCCAGAACTTCTTCATACTTTTAATATCTATTTTACCTTCTATTCAATCACAGAATCGCACAAACTGTGATCGCTCATGCCCCGGCGGTGACTTCAATCCCGTCCGCTACCCATTTGGCTTCTCCTCCGGCTGCGAAATCCAACTCAACTGCACCCCCCAAGGCGATGTTTTAATCGGCGAATTCCCGGTCCAACAAATAAACTCCGATGGCTTACTTGTCAGTCTTCCGGCCATGTGTGGACGCGCCTT...

Protein

Download Protein FASTA

689 aa · TkA03G298770|TK1151|PROTEIN

MIKLQNFFILLISILPSIQSQNRTNCDRSCPGGDFNPVRYPFGFSSGCEIQLNCTPQGDVLIGEFPVQQINSDGLLVSLPAMCGRAFNSLSHLYGENYAPTSTNAILMQNCTEQMKNCMIPMTDLRTHLEIVNCSGGDGGNYSNVSCYSGDLAGMFLDYKNMSGVGCRYLFSAVSTEFVGASPAVSLSMQVVKLGWWVKGACDCSSGANCTTIVSPSDGSHGYRCKCNSGFDGDGYKSGSGCRMDKDSSGCNPSKYFSGD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G298770`
TK1151 ID	TkA03G298770
OH-1004 ID	LXL04_008989
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G298770

Location Chr03:73492676-73503240 (+)

Description Similar to WAKL14: Wall-associated receptor kinase-like 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23450`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At5g66790`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g18390`	Probable receptor-like serine/threonine-protein kinase involved in abscisic acid (ABA) signaling.	The AtLRK10L1.2, Arabidopsis ortholog of wheat LRK10, is involved in ABA-mediated signaling and drought resistance.2015 · DOI: 10.1007/s00299-014-1724-2
`At1g25390`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1.	No verified direct reference in this release
`At3g53840`	Putative serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008989 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0010089 xylem development Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030247 polysaccharide binding Molecular Function

KEGG gene cross-reference

ath:AT1G18390

ath:AT1G25390

ath:AT2G23450

ath:AT5G38210

ath:AT5G66790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.882

Rank 1 · TkA03G298770 · TK1151

Cytoplasm0.078

Rank 2 · TkA03G298770 · TK1151

Endoplasmic reticulum0.069

Rank 3 · TkA03G298770 · TK1151

Nucleus0.053

Rank 4 · TkA03G298770 · TK1151

Lysosome / Vacuole0.023

Rank 5 · TkA03G298770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08995NIP_1109-142 aa

PF08995NIP_1202-226 aa

PF00008EGF204-234 aa

PF12662cEGF222-237 aa

PF21314TM_ErbB1273-300 aa

PF03109ABC1327-362 aa

PF00069Pkinase331-600 aa

PF07714PK_Tyr_Ser-Thr333-603 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G298770	`PF08995`	NIP_1	109	142	1.1	10.4
TkA03G298770	`PF08995`	NIP_1	202	226	1.1	10.4
TkA03G298770	`PF00008`	EGF	204	234	0.13	13.3
TkA03G298770	`PF12662`	cEGF	222	237	1.5	9.5
TkA03G298770	`PF21314`	TM_ErbB1	273	300	0.48	10.9
TkA03G298770	`PF03109`	ABC1	327	362	0.00034	20.6
TkA03G298770	`PF00069`	Pkinase	331	600	5.8e-46	157.7
TkA03G298770	`PF07714`	PK_Tyr_Ser-Thr	333	603	8.4e-45	153.8
TkA03G298770	`PF03109`	ABC1	399	478	0.00034	20.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY67`	Arabidopsis thaliana	sp\|Q8RY67\|WAKLO_ARATH Wall-associated receptor kinase-like 14	49.600%	Swiss-Prot	Medium
`Q8GYF5`	Arabidopsis thaliana	sp\|Q8GYF5\|WAKLR_ARATH Wall-associated receptor kinase-like 21	47.900%	Swiss-Prot	Medium
`P0C5E2`	Arabidopsis thaliana	sp\|P0C5E2\|LRL12_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.2	48.500%	Swiss-Prot	Low
`Q9C6K9`	Arabidopsis thaliana	sp\|Q9C6K9\|LRL11_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1	45.300%	Swiss-Prot	Low
`Q9M342`	Arabidopsis thaliana	sp\|Q9M342\|WAKLP_ARATH Wall-associated receptor kinase-like 15	48.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card