RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G294940
Reference: TK1151 Chr: Chr03 Coordinates: 72688034-72689065 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

747 bp · TkA03G294940|TK1151|cDNA

ATGTGGATTTTATACTATGATGCTTATCAGTATTACTACTGGTTTCTAGCGTTTCGCATGTGGCAACACAGGTTACCTACATTGGGTAAATTTCCGAAATTCTTCACGAGGTTGCATGCAATACTGGCAAGAATTTACACTTGGGGGCATACCCGGAAAGTTTTTGACAGCGTTAAGGGGATGTTCTGGGTTCAGAAAATGCATAATAACAAGTTATCTCGTGATAAAGGGCTGAATCGGAAGCAACTTTTCTTGGAAAT...

CDS

Download CDS FASTA

747 bp · TkA03G294940|TK1151|CDS

ATGTGGATTTTATACTATGATGCTTATCAGTATTACTACTGGTTTCTAGCGTTTCGCATGTGGCAACACAGGTTACCTACATTGGGTAAATTTCCGAAATTCTTCACGAGGTTGCATGCAATACTGGCAAGAATTTACACTTGGGGGCATACCCGGAAAGTTTTTGACAGCGTTAAGGGGATGTTCTGGGTTCAGAAAATGCATAATAACAAGTTATCTCGTGATAAAGGGCTGAATCGGAAGCAACTTTTCTTGGAAAT...

Protein

Download Protein FASTA

248 aa · TkA03G294940|TK1151|PROTEIN

MWILYYDAYQYYYWFLAFRMWQHRLPTLGKFPKFFTRLHAILARIYTWGHTRKVFDSVKGMFWVQKMHNNKLSRDKGLNRKQLFLEISTWISFVRKNSNKGHFRKVVAVWGCLGNLLLSLIRKWLQVHRMGLIIFLYRDVGLLRDMPNPNCRGQFRYFGTWQLFFCIGTWQLMGLMLKWLFMEESITDLTRKRFMLLICHVNWDHSCKEIVWFPYNFSTDLVLIRIISRESKEKGFPRMIRREISRFK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G294940
TK1151 IDTkA03G294940
OH-1004 IDLXL04_008727
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)96.500
Protein coverage (%)TK1151 58.065 / OH-1004 51.064
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G294940
LocationChr03:72688034-72689065 (+)
DescriptionSimilar to ABC1K8: Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_008727 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006744 ubiquinone biosynthetic process Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0007623 circadian rhythm Biological Process
GO:0009644 response to high light intensity Biological Process
GO:0010150 leaf senescence Biological Process
GO:0010795 regulation of ubiquinone biosynthetic process Biological Process
GO:0034599 cellular response to oxidative stress Biological Process
GO:0042542 response to hydrogen peroxide Biological Process
GO:0046467 membrane lipid biosynthetic process Biological Process
GO:0046686 response to cadmium ion Biological Process
GO:1901031 regulation of response to reactive oxygen species Biological Process
GO:1990641 response to iron ion starvation Biological Process
KEGG gene cross-reference
ath:AT5G64940
bph:Bphy_0377
pmy:Pmen_0521
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.304
Rank 1 · TkA03G294940 · TK1151
Cytoplasm0.287
Rank 2 · TkA03G294940 · TK1151
Nucleus0.215
Rank 3 · TkA03G294940 · TK1151
Plastid0.074
Rank 4 · TkA03G294940 · TK1151
Cell membrane0.057
Rank 5 · TkA03G294940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser