TkA03G290040 | RubberDandelionOmics

Gene overview

TkA03G290040

Reference: TK1151 Chr: Chr03 Coordinates: 71503067-71503711 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

582 bp · TkA03G290040|TK1151|cDNA

ATGCAAGAAAACACTCAAAGAACTTATACGGCTGCTAATGATTTGTTGAATCTTGATTATAACGCAGAAAGTGAGTACGTCATGTGTCCTGGCGAAGAAATCACCATCGCTAAAGGATACTCAAGCATTATAGAATCATTAGCATCTGTTTTACCATCTGGGGTCATTCAATTAGGTAAAAAAGTTTCCAAAATTGAATGGAATCCTGAATGTACAAGACCAGTCACACTACACTTTCTTGATGGTACAACTCTATCAGC...

CDS

Download CDS FASTA

582 bp · TkA03G290040|TK1151|CDS

ATGCAAGAAAACACTCAAAGAACTTATACGGCTGCTAATGATTTGTTGAATCTTGATTATAACGCAGAAAGTGAGTACGTCATGTGTCCTGGCGAAGAAATCACCATCGCTAAAGGATACTCAAGCATTATAGAATCATTAGCATCTGTTTTACCATCTGGGGTCATTCAATTAGGTAAAAAAGTTTCCAAAATTGAATGGAATCCTGAATGTACAAGACCAGTCACACTACACTTTCTTGATGGTACAACTCTATCAGC...

Protein

Download Protein FASTA

193 aa · TkA03G290040|TK1151|PROTEIN

MQENTQRTYTAANDLLNLDYNAESEYVMCPGEEITIAKGYSSIIESLASVLPSGVIQLGKKVSKIEWNPECTRPVTLHFLDGTTLSADHVIVTVSLGVLKAGNLKFNPPLPDYKIEAISRLGYGVVNKLFLQLSPEYTDFDQFPFLQFLFHQSDSEVKDPRIPWWIRRTAFISPIYRKSRVLLSWLQVKKHLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G290040`
TK1151 ID	TkA03G290040
OH-1004 ID	LXL04_002430
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	71.400
Protein coverage (%)	TK1151 95.855 / OH-1004 39.272 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G290040

Location Chr03:71503067-71503711 (+)

Description Similar to PAO5: Probable polyamine oxidase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29720`	Flavoenzyme involved in polyamine back-conversion.	A plant spermine oxidase/dehydrogenase regulated by the proteasome and polyamines.2014 · DOI: 10.1093/jxb/eru016 Polyamine Oxidase5 Regulates Arabidopsis Growth through Thermospermine Oxidase Activity.2014 · DOI: 10.1104/pp.114.242610 Reducing Cytoplasmic Polyamine Oxidase Activity in Arabidopsis Increases Salt and Drought Tolerance by Reducing Reactive Oxygen Species Production and Increasing Defense Gene Expression.2016 · DOI: 10.3389/fpls.2016.00214 The Arabidopsis polyamine oxidase/dehydrogenase 5 interferes with cytokinin and auxin signaling pathways to control xylem differentiation.2017 · DOI: 10.1093/jxb/erw510

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0710200`	Flavoenzyme involved in polyamine back-conversion.	Oryza sativa polyamine oxidase 1 back-converts tetraamines, spermine and thermospermine, to spermidine.2014 · DOI: 10.1007/s00299-013-1518-y
`Os08g0143400`	Probable histone demethylase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002430 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006596 polyamine biosynthetic process Biological Process

GO:0006598 polyamine catabolic process Biological Process

GO:0006805 xenobiotic metabolic process Biological Process

GO:0009446 putrescine biosynthetic process Biological Process

GO:0009447 putrescine catabolic process Biological Process

GO:0046203 spermidine catabolic process Biological Process

GO:0046208 spermine catabolic process Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:1901307 positive regulation of spermidine biosynthetic process Biological Process

GO:1903602 thermospermine catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT4G29720

dosa:Os01g0710200

hsa:54498

mmu:212503

mmu:228608

osa:4327828

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.427

Rank 1 · TkA03G290040 · TK1151

Extracellular0.176

Rank 2 · TkA03G290040 · TK1151

Nucleus0.165

Rank 3 · TkA03G290040 · TK1151

Peroxisome0.141

Rank 4 · TkA03G290040 · TK1151

Mitochondrion0.062

Rank 5 · TkA03G290040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01593Amino_oxidase17-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G290040	`PF01593`	Amino_oxidase	17	134	1.4e-25	91.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU79`	Arabidopsis thaliana	sp\|Q9SU79\|PAO5_ARATH Probable polyamine oxidase 5	60.200%	Swiss-Prot	High
`Q5NAI7`	Oryza sativa subsp. japonica	sp\|Q5NAI7\|PAO1_ORYSJ Polyamine oxidase 1	45.000%	Swiss-Prot	Medium
`Q6YYZ1`	Oryza sativa subsp. japonica	sp\|Q6YYZ1\|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2	31.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card