TkA03G289260 | RubberDandelionOmics

Gene overview

TkA03G289260

Reference: TK1151 Chr: Chr03 Coordinates: 71352028-71352759 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

732 bp · TkA03G289260|TK1151|cDNA

ATGCCCGATGGAAAAAGACGCGTTTGGGAAAGCGTTGACTTTCGGTCAACGCTCAAAACTCTCCCTCCAAGAACAACGACAAAGCCTCCCAATCTACAAACTCAAAAAAGAACTCGTCCAAGCCGTCCACGACAACCAGGTGTTGGTAGTCATCGGGAAACCGGGTCCGGGAAAACAACTCAGGTGACTCAGTACCTAGCGGAAGCCGGGTACACCACCAAGGGCAAAATCGGGTGCACGCAGCCCCGCCGAGTCGCCGC...

CDS

Download CDS FASTA

732 bp · TkA03G289260|TK1151|CDS

ATGCCCGATGGAAAAAGACGCGTTTGGGAAAGCGTTGACTTTCGGTCAACGCTCAAAACTCTCCCTCCAAGAACAACGACAAAGCCTCCCAATCTACAAACTCAAAAAAGAACTCGTCCAAGCCGTCCACGACAACCAGGTGTTGGTAGTCATCGGGAAACCGGGTCCGGGAAAACAACTCAGGTGACTCAGTACCTAGCGGAAGCCGGGTACACCACCAAGGGCAAAATCGGGTGCACGCAGCCCCGCCGAGTCGCCGC...

Protein

Download Protein FASTA

243 aa · TkA03G289260|TK1151|PROTEIN

MPDGKRRVWESVDFRSTLKTLPPRTTTKPPNLQTQKRTRPSRPRQPGVGSHRETGSGKTTQVTQYLAEAGYTTKGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPETVIKYMTDGMLLREILIDENLSQYSVIMLDEAHERTIHTDVLFGLLKQLIRRRPDLRLIVTSATLDAEKFSGYFFSCNIFTIPGRTFPVEILYTKQPESDYLDAALITVMQIHLTEPEGDILVF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G289260`
TK1151 ID	TkA03G289260
OH-1004 ID	LXL04_027861
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 78.601 / OH-1004 15.864 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G289260

Location Chr03:71352028-71352759 (+)

Description Similar to At3g26560: Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26560`	May be involved in pre-mRNA splicing.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027861 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006396 RNA processing Biological Process

GO:0007281 germ cell development Biological Process

GO:0008380 RNA splicing Biological Process

GO:0010172 embryonic body morphogenesis Biological Process

GO:0048589 developmental growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G26560

cel:CELE_EEED8.5

ddi:DDB_G0291183

hsa:1659

mmu:217207

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.527

Rank 1 · TkA03G289260 · TK1151

Cytoplasm0.447

Rank 2 · TkA03G289260 · TK1151

Mitochondrion0.110

Rank 3 · TkA03G289260 · TK1151

Plastid0.038

Rank 4 · TkA03G289260 · TK1151

Peroxisome0.037

Rank 5 · TkA03G289260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270DEAD53-185 aa

PF13401AAA_2253-169 aa

PF07652Flavi_DEAD54-152 aa

PF13245AAA_1955-169 aa

PF00004AAA90-173 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G289260	`PF00270`	DEAD	53	185	9.5e-07	29.4
TkA03G289260	`PF13401`	AAA_22	53	169	0.0013	19.7
TkA03G289260	`PF07652`	Flavi_DEAD	54	152	0.033	14.9
TkA03G289260	`PF13245`	AAA_19	55	169	0.079	13.9
TkA03G289260	`PF00004`	AAA	90	173	0.19	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38953`	Arabidopsis thaliana	sp\|Q38953\|DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5	95.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card