TkA03G282550 | RubberDandelionOmics

Gene overview

TkA03G282550

Reference: TK1151 Chr: Chr03 Coordinates: 69703756-69710119 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3792 bp · TkA03G282550|TK1151|cDNA

CCCGTCTCCACACCAACTTCAACCTCCATCATTAACTACAATATGACTCTGTTTCCTACGATTCATCGGCATTTTCAAGAGAAAGAATCGAACGAGAAGAACCCGAATTGCAAAATTAACCTTTACGCCTTCAATCTTTCTCTCTTCAACACGAATATAACTGGTTCTTCCTTCCAGGCCCAGTATCTTGGCTCAGCCCCTTCGTTCCCCATCTTCATTCCTTCTTATTTCAATTTTTATCCATTGATTTGTGGAATATA...

CDS

Download CDS FASTA

2358 bp · TkA03G282550|TK1151|CDS

ATGTATGCTGTAGGGAAGTTAAGTAGCTATATCAGTCAAGGGGTTTACACTGTCTCAGGCCCCTTTCATCCATTCGGTGGGGCTGTTGACATGGTTGTGGTTCAACAACAAGATGGTAGCTTGAAATCATCTCCTTGGTATGTTCGATTTGGGAAGTTTCAAGGGGTTTTGAAAGCAAAAGAGAGAATTGTCGACATTAATGTTAATGGGGTTGATGCTGGTTTCAACATGTATTTAGATCCAAGAGGGGAGGCTTACTT...

Protein

Download Protein FASTA

785 aa · TkA03G282550|TK1151|PROTEIN

MYAVGKLSSYISQGVYTVSGPFHPFGGAVDMVVVQQQDGSLKSSPWYVRFGKFQGVLKAKERIVDINVNGVDAGFNMYLDPRGEAYFLREIDSEEEVVEPVSSHLSMCEEIDGKNHEKITVKSKSMNYDFDHSNSDDGNVLGRNNSKRSRILGFVLGRRSMNEQILSKEENDSNSGRIMEGEIAADLLEMKWSTNFSSRNSMNKHNESRKDNGEMEITGGRLEGSLVLHEQHFVNKLETPRVDDETTVATIDKEEKLNDH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G282550`
TK1151 ID	TkA03G282550
OH-1004 ID	LXL04_008162
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G282550

Location Chr03:69703756-69710119 (-)

Description Similar to PAH2: Phosphatidate phosphatase PAH2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42870`	Magnesium-dependent phosphatidate phosphatase which catalyzes the dephosphorylation of phosphatidate to yield diacylglycerol.	Arabidopsis lipins mediate eukaryotic pathway of lipid metabolism and cope critically with phosphate starvation.2009 · DOI: 10.1073/pnas.0907173106 Phosphatidic acid phosphohydrolase 1 and 2 regulate phospholipid synthesis at the endoplasmic reticulum in Arabidopsis.2010 · DOI: 10.1105/tpc.109.071423
`At3g09560`	Magnesium-dependent phosphatidate phosphatase which catalyzes the dephosphorylation of phosphatidate to yield diacylglycerol.	Arabidopsis lipins mediate eukaryotic pathway of lipid metabolism and cope critically with phosphate starvation.2009 · DOI: 10.1073/pnas.0907173106 Phosphatidic acid phosphohydrolase 1 and 2 regulate phospholipid synthesis at the endoplasmic reticulum in Arabidopsis.2010 · DOI: 10.1105/tpc.109.071423 Lipins from plants are phosphatidate phosphatases that restore lipid synthesis in a pah1Δ mutant strain of Saccharomyces cerevisiae.2011 · DOI: 10.1111/j.1742-4658.2010.07995.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008162 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0009062 fatty acid catabolic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0019375 galactolipid biosynthetic process Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0032869 cellular response to insulin stimulus Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G09560

ath:AT5G42870

hsa:9663

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.286

Rank 1 · TkA03G282550 · TK1151

Endoplasmic reticulum0.254

Rank 2 · TkA03G282550 · TK1151

Nucleus0.218

Rank 3 · TkA03G282550 · TK1151

Golgi apparatus0.214

Rank 4 · TkA03G282550 · TK1151

Cell membrane0.164

Rank 5 · TkA03G282550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04571Lipin_N4-99 aa

PF05031NEAT111-145 aa

PF05031NEAT209-278 aa

PF25109HAD_PNKP310-338 aa

PF08235LNS2539-762 aa

PF05031NEAT548-566 aa

PF25109HAD_PNKP585-644 aa

PF24694LNS2_PITM1-3587-733 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G282550	`PF04571`	Lipin_N	4	99	2e-27	96.0
TkA03G282550	`PF05031`	NEAT	111	145	1.3	10.2
TkA03G282550	`PF05031`	NEAT	209	278	1.3	10.2
TkA03G282550	`PF25109`	HAD_PNKP	310	338	0.025	15.4
TkA03G282550	`PF08235`	LNS2	539	762	2.7e-94	315.5
TkA03G282550	`PF05031`	NEAT	548	566	1.3	10.2
TkA03G282550	`PF25109`	HAD_PNKP	585	644	0.025	15.4
TkA03G282550	`PF24694`	LNS2_PITM1-3	587	733	1.5e-05	25.7
TkA03G282550	`PF09949`	APP1_cat	587	703	0.00057	20.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMN2`	Arabidopsis thaliana	sp\|Q9FMN2\|PAH2_ARATH Phosphatidate phosphatase PAH2	40.900%	Swiss-Prot	Medium
`Q9SF47`	Arabidopsis thaliana	sp\|Q9SF47\|PAH1_ARATH Phosphatidate phosphatase PAH1	37.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card