TkA03G252120 | RubberDandelionOmics

Gene overview

TkA03G252120

Reference: TK1151 Chr: Chr03 Coordinates: 62510588-62511584 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · TkA03G252120|TK1151|cDNA

ATGGTGAAGAAGGGTAAAATAGAGAATTCACATTGTCAGGCTGTACCCATGAAGGAAACCCCTATCAAGAGGAAGTATCAGAATCTTGAAGATGACGGCAACGGCAACACTGAAATAATTGATAACCGCAAAAAGAAAAGTCGGGTTGCAAGAGATAATAAAAACAAGAAGAATTTGCCACCAATGAACAAAAAGATGACGAGTGCTACTAATAGCAATGAAGATGAAACCAAAGAGAAACAATTAAACAATGAAGATTT...

CDS

Download CDS FASTA

624 bp · TkA03G252120|TK1151|CDS

ATGGTGAAGAAGGGTAAAATAGAGAATTCACATTGTCAGGCTGTACCCATGAAGGAAACCCCTATCAAGAGGAAGTATCAGAATCTTGAAGATGACGGCAACGGCAACACTGAAATAATTGATAACCGCAAAAAGAAAAGTCGGGTTGCAAGAGATAATAAAAACAAGAAGAATTTGCCACCAATGAACAAAAAGATGACGAGTGCTACTAATAGCAATGAAGATGAAACCAAAGAGAAACAATTAAACAATGAAGATTT...

Protein

Download Protein FASTA

207 aa · TkA03G252120|TK1151|PROTEIN

MVKKGKIENSHCQAVPMKETPIKRKYQNLEDDGNGNTEIIDNRKKKSRVARDNKNKKNLPPMNKKMTSATNSNEDETKEKQLNNEDFTQNISSSCSEDDSNASQDVKEGPINVTQRPRASRGAATDPQSVYARKRRERINEKLRILQNIVPNGTKVDMSTMLEEAVQYVKFLQLQIKLLSSDDMWMYAPIAYNGMDMGLYQNMSHNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G252120`
TK1151 ID	TkA03G252120
OH-1004 ID	LXL04_007953
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 58.475 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G252120

Location Chr03:62510588-62511584 (-)

Description Similar to RSL2: Transcription factor RSL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g14760`	Transcription factor bHLH84.	No verified direct reference in this release
`At1g27740`	Transcription factor involved in the regulation of root hair elongation.	A basic helix-loop-helix transcription factor controls cell growth and size in root hairs.2010 · DOI: 10.1038/ng.529 Intensity of a pulse of RSL4 transcription factor synthesis determines Arabidopsis root hair cell size.2015 · DOI: 10.1038/nplants.2015.138 ROOT HAIR DEFECTIVE SIX-LIKE4 (RSL4) promotes root hair elongation by transcriptionally regulating the expression of genes required for cell growth.2016 · DOI: 10.1111/nph.14095 A mechanistic framework for auxin dependent Arabidopsis root hair elongation to low external phosphate.2018 · DOI: 10.1038/s41467-018-03851-3
`At4g33880`	Transcription factor involved in the regulation of root hair elongation.	A mechanistic framework for auxin dependent Arabidopsis root hair elongation to low external phosphate.2018 · DOI: 10.1038/s41467-018-03851-3
`At5g43175`	Transcription factor bHLH139.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0508500`	Transcription factor that acts as a regulator of iron homeostasis.	Identification of OsbHLH133 as a regulator of iron distribution between roots and shoots in Oryza sativa.2013 · DOI: 10.1111/j.1365-3040.2012.02569.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007953 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009555 pollen development Biological Process

GO:0009733 response to auxin Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048766 root hair initiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G27740

ath:AT2G14760

ath:AT4G33880

ath:AT5G43175

osa:107276670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.981

Rank 1 · TkA03G252120 · TK1151

Cytoplasm0.074

Rank 2 · TkA03G252120 · TK1151

Cell membrane0.021

Rank 3 · TkA03G252120 · TK1151

Endoplasmic reticulum0.011

Rank 4 · TkA03G252120 · TK1151

Plastid0.008

Rank 5 · TkA03G252120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010HLH133-173 aa

PF23173bHLH_SAC51133-178 aa

PF23176bHLH_LHW136-173 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G252120	`PF00010`	HLH	133	173	6.4e-09	36.2
TkA03G252120	`PF23173`	bHLH_SAC51	133	178	2.8e-08	34.3
TkA03G252120	`PF23176`	bHLH_LHW	136	173	0.00017	22.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XHI9`	Arabidopsis thaliana	sp\|Q7XHI9\|BH084_ARATH Transcription factor bHLH84	73.200%	Swiss-Prot	Medium
`Q8LEG1`	Arabidopsis thaliana	sp\|Q8LEG1\|RSL4_ARATH Transcription factor RSL3	69.400%	Swiss-Prot	Medium
`Q84WK0`	Arabidopsis thaliana	sp\|Q84WK0\|RSL2_ARATH Transcription factor RSL2	84.300%	Swiss-Prot	Low
`Q3E7L7`	Arabidopsis thaliana	sp\|Q3E7L7\|BH139_ARATH Transcription factor bHLH139	60.500%	Swiss-Prot	Medium
`Q2QQ32`	Oryza sativa subsp. japonica	sp\|Q2QQ32\|BH133_ORYSJ Transcription factor BHLH133	70.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card