TkA03G248230 | RubberDandelionOmics

Gene overview

TkA03G248230

Reference: TK1151 Chr: Chr03 Coordinates: 61682672-61683031 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · TkA03G248230|TK1151|cDNA

TCCGCTCTGTTTCCACCTGCCTCACCCGTACCGCTTCCGGAAATTTCCCATGTCGGTTTATTGAGTCGGTGGCCTCTGTATTATTGCCGCCTTCCTTCACCTACCTCATGGTCACTTAATGCAATGCTTACTTCTCAATTTGGTGATGTGAAGAAGGAGATTGTAGTTTTTGGGGAGAATAAATCTGTGGAAGACTTTTTAGGAGATTATTTTGGGTTTCACCATCATCAGTTACCACTTGCAGGCGTTCTTCTTGCCTT...

CDS

Download CDS FASTA

360 bp · TkA03G248230|TK1151|CDS

TCCGCTCTGTTTCCACCTGCCTCACCCGTACCGCTTCCGGAAATTTCCCATGTCGGTTTATTGAGTCGGTGGCCTCTGTATTATTGCCGCCTTCCTTCACCTACCTCATGGTCACTTAATGCAATGCTTACTTCTCAATTTGGTGATGTGAAGAAGGAGATTGTAGTTTTTGGGGAGAATAAATCTGTGGAAGACTTTTTAGGAGATTATTTTGGGTTTCACCATCATCAGTTACCACTTGCAGGCGTTCTTCTTGCCTT...

Protein

Download Protein FASTA

119 aa · TkA03G248230|TK1151|PROTEIN

SALFPPASPVPLPEISHVGLLSRWPLYYCRLPSPTSWSLNAMLTSQFGDVKKEIVVFGENKSVEDFLGDYFGFHHHQLPLAGVLLALYPIILAISLSTALRAALMLFLLLVSILFLHFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G248230`
TK1151 ID	TkA03G248230
OH-1004 ID	LXL04_025512
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.100
Protein coverage (%)	TK1151 84.874 / OH-1004 62.733 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G248230

Location Chr03:61682672-61683031 (+)

Description Similar to PDR3: Pleiotropic drug resistance protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15233`	May be a general defense protein.	No verified direct reference in this release
`At4g15236`	May be a general defense protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0528900`	May be a general defense protein.	No verified direct reference in this release
`Os12g0512700`	May be a general defense protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025512 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G15233

ath:AT4G15236

dosa:Os02g0528900

dosa:Os12g0512700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.380

Rank 1 · TkA03G248230 · TK1151

Nucleus0.247

Rank 2 · TkA03G248230 · TK1151

Cytoplasm0.159

Rank 3 · TkA03G248230 · TK1151

Golgi apparatus0.140

Rank 4 · TkA03G248230 · TK1151

Plastid0.119

Rank 5 · TkA03G248230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7PC82`	Arabidopsis thaliana	sp\|Q7PC82\|AB42G_ARATH ABC transporter G family member 42	53.400%	Swiss-Prot	Medium
`Q7PC81`	Arabidopsis thaliana	sp\|Q7PC81\|AB43G_ARATH ABC transporter G family member 43	52.100%	Swiss-Prot	Medium
`Q8GU83`	Oryza sativa subsp. japonica	sp\|Q8GU83\|AB41G_ORYSJ ABC transporter G family member 41	53.500%	Swiss-Prot	High
`B9GDE5`	Oryza sativa subsp. japonica	sp\|B9GDE5\|AB50G_ORYSJ ABC transporter G family member 50	51.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card