TkA03G224390 | RubberDandelionOmics

Gene overview

TkA03G224390

Reference: TK1151 Chr: Chr03 Coordinates: 56086015-56086783 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

703 bp · TkA03G224390|TK1151|cDNA

ATGCCTCTAGCGAAAAAGTTTGAACACCTTCGGATAGAACTAAAAGCTATAGAATCAGCAACAAACAACTTCGATTACCACAACTGCATTGGAAGAGGAGGTTTTGGAAAAGTGTATAAGGGAGAGCTTGTTCATTCCAAAGGGCCTACCATTGTTGCTGTAAAGCGATTAGATCCCGCATTTGGTCAAGGAAATCCAGAATTCTGGAAGGAGATCATTGTACTTTGTCTTTACAACCATGAGAATATTGTTTCTCTATT...

CDS

Download CDS FASTA

702 bp · TkA03G224390|TK1151|CDS

ATGCCTCTAGCGAAAAAGTTTGAACACCTTCGGATAGAACTAAAAGCTATAGAATCAGCAACAAACAACTTCGATTACCACAACTGCATTGGAAGAGGAGGTTTTGGAAAAGTGTATAAGGGAGAGCTTGTTCATTCCAAAGGGCCTACCATTGTTGCTGTAAAGCGATTAGATCCCGCATTTGGTCAAGGAAATCCAGAATTCTGGAAGGAGATCATTGTACTTTGTCTTTACAACCATGAGAATATTGTTTCTCTATT...

Protein

Download Protein FASTA

234 aa · TkA03G224390|TK1151|PROTEIN

MPLAKKFEHLRIELKAIESATNNFDYHNCIGRGGFGKVYKGELVHSKGPTIVAVKRLDPAFGQGNPEFWKEIIVLCLYNHENIVSLLGFCDENNEKILVYEYASRGSLDLYLNNDEPGKTQQRVLHRDVKSSNILLDECWNAKISDLGLSKFGPSNQQYTFLVSNLVSTIGYCDPIYVEIGLLTKESDVYSFGVVLFEVLCGRLCISNKDGIHKSLTTLVRRYYAQNKINEIIH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G224390`
TK1151 ID	TkA03G224390
OH-1004 ID	LXL04_017665
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	69.900
Protein coverage (%)	TK1151 100.000 / OH-1004 39.024 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G224390

Location Chr03:56086015-56086783 (-)

Description Similar to PTI1: Pto-interacting protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At1g30570`	Probable receptor-like protein kinase At1g30570.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At3g07070`	May be involved in plant defense signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017665 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G48210

ath:AT3G17410

sly:544006

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.625

Rank 1 · TkA03G224390 · TK1151

Nucleus0.268

Rank 2 · TkA03G224390 · TK1151

Cell membrane0.228

Rank 3 · TkA03G224390 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA03G224390 · TK1151

Lysosome / Vacuole0.045

Rank 5 · TkA03G224390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr27-116 aa

PF00069Pkinase27-115 aa

PF07718Coatamer_beta_C80-92 aa

PF07714PK_Tyr_Ser-Thr121-202 aa

PF00069Pkinase121-214 aa

PF07718Coatamer_beta_C156-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G224390	`PF07714`	PK_Tyr_Ser-Thr	27	116	9.5e-34	117.6
TkA03G224390	`PF00069`	Pkinase	27	115	3.6e-32	112.5
TkA03G224390	`PF07718`	Coatamer_beta_C	80	92	0.19	12.4
TkA03G224390	`PF07714`	PK_Tyr_Ser-Thr	121	202	9.5e-34	117.6
TkA03G224390	`PF00069`	Pkinase	121	214	3.6e-32	112.5
TkA03G224390	`PF07718`	Coatamer_beta_C	156	189	0.19	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN92`	Arabidopsis thaliana	sp\|Q9FN92\|Y5597_ARATH Probable receptor-like protein kinase At5g59700	48.600%	Swiss-Prot	Medium
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	48.600%	Swiss-Prot	Medium
`Q9SA72`	Arabidopsis thaliana	sp\|Q9SA72\|Y1357_ARATH Probable receptor-like protein kinase At1g30570	45.500%	Swiss-Prot	Medium
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	39.600%	Swiss-Prot	Medium
`Q9SFT7`	Arabidopsis thaliana	sp\|Q9SFT7\|PBL26_ARATH Probable serine/threonine-protein kinase PBL26	42.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card