Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3838 bp · TkA03G207800|TK1151|cDNA
GTAAGTTACTCGAAATTTTTCAGTGTAGCTTTTCCAAGTTTTCACTTCCCCCCTAAGTCCCTTCTTTCGCGCCCTCTAGTTTCAACTCCGACGATGGCGGACGCCGACGGTAAGGCTGCAAAGGAACTGATTCGCGATGTCGGCAAACAACTCGCTGCCAAACAGAAATGTCCTCACAAAGATTCCCTCGTAAAATTGCTCCGACAAGCTGCAAGTGCATTACCAAAGTTAAAAACACAATCAGACTTGCTAAAGCCTGC...
1827 bp · TkA03G207800|TK1151|CDS
GTAAGTTACTCGAAATTTTTCAGTGTAGCTTTTCCAAGTTTTCACTTCCCCCCTAAGTCCCTTCTTTCGCGCCCTCTAGTTTCAACTCCGACGATGGCGGACGCCGACGGTAAGGCTGCAAAGGAACTGATTCGCGATGTCGGCAAACAACTCGCTGCCAAACAGAAATGTCCTCACAAAGATTCCCTCGTAAAATTGCTCCGACAAGCTGCAAGTGCATTACCAAAGTTAAAAACACAATCAGACTTGCTAAAGCCTGC...
Protein
Download Protein FASTA608 aa · TkA03G207800|TK1151|PROTEIN
VSYSKFFSVAFPSFHFPPKSLLSRPLVSTPTMADADGKAAKELIRDVGKQLAAKQKCPHKDSLVKLLRQAASALPKLKTQSDLLKPAIKPLIDSLVKHGLLRQKDKDVRLLVAICVCEILRILAPNPGFSDEDFRDIYQLFLGMFAELGDTKSPYFSKRVALLETIAKFNFCVLMLDTGCEDLVLKMFNIFFSVIRKEHPSNVYGAMSSIMSLIFQEKSSQELLEVILQSLIKESKDASPASFQLGVSVIEGCSEAIQPV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G207800 |
|---|---|
| TK1151 ID | TkA03G207800 |
| OH-1004 ID | LXL04_007694 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 98.800 |
| Protein coverage (%) | TK1151 81.908 / OH-1004 45.314Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G207800 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:52171075-52182089 (+) | |||||||||
| Description | Similar to PDS5A: Sister chromatid cohesion protein PDS5 homolog A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0007064 mitotic sister chromatid cohesion Biological Process GO:0008156 negative regulation of DNA replication Biological Process GO:0009556 microsporogenesis Biological Process GO:0009952 anterior/posterior pattern specification Biological Process GO:0009954 proximal/distal pattern formation Biological Process GO:0009965 leaf morphogenesis Biological Process GO:0035825 homologous recombination Biological Process GO:0051301 cell division Biological Process GO:0097402 neuroblast migration Biological Process GO:0000775 chromosome, centromeric region Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G77600 ath:AT5G47690 gga:422787 hsa:23244 rno:305343 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF29896PPFR1_M30-104 aaPF03500Cellsynth_D34-74 aaPF20168PDS561-516 aaPF13646HEAT_268-79 aaPF12717Cnd169-121 aaPF13513HEAT_EZ69-115 aaPF24714TOR1L1_N70-112 aaPF23271HEAT_GCN183-114 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G207800 | PF29896 | PPFR1_M | 30 | 104 | 0.014 | 16.6 |
| TkA03G207800 | PF03500 | Cellsynth_D | 34 | 74 | 0.11 | 13.1 |
| TkA03G207800 | PF20168 | PDS5 | 61 | 516 | 7.3e-143 | 478.4 |
| TkA03G207800 | PF13646 | HEAT_2 | 68 | 79 | 0.029 | 15.4 |
| TkA03G207800 | PF12717 | Cnd1 | 69 | 121 | 1.7e-07 | 32.2 |
| TkA03G207800 | PF13513 | HEAT_EZ | 69 | 115 | 0.0045 | 18.2 |
| TkA03G207800 | PF24714 | TOR1L1_N | 70 | 112 | 0.00044 | 20.4 |
| TkA03G207800 | PF23271 | HEAT_GCN1 | 83 | 114 | 0.0011 | 19.9 |
| TkA03G207800 | PF25780 | TPR_IPO5 | 91 | 108 | 0.016 | 16.3 |
| TkA03G207800 | PF02985 | HEAT | 100 | 122 | 2.7e-05 | 24.7 |
| TkA03G207800 | PF29896 | PPFR1_M | 100 | 142 | 0.014 | 16.6 |
| TkA03G207800 | PF12717 | Cnd1 | 183 | 268 | 1.7e-07 | 32.2 |
| TkA03G207800 | PF25780 | TPR_IPO5 | 204 | 224 | 0.016 | 16.3 |
| TkA03G207800 | PF23271 | HEAT_GCN1 | 206 | 238 | 0.0011 | 19.9 |
| TkA03G207800 | PF25786 | HEAT_GCN1_C | 213 | 242 | 0.00021 | 22.1 |
| TkA03G207800 | PF13513 | HEAT_EZ | 246 | 261 | 0.0045 | 18.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.