TkA03G206130 | RubberDandelionOmics

Gene overview

TkA03G206130

Reference: TK1151 Chr: Chr03 Coordinates: 51725856-51732025 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3108 bp · TkA03G206130|TK1151|cDNA

TTTGTACTAGATGCCAACCCTAACCCTAATCTTAACCAAAGCAGAAGGCAAAGGGCATGGTAAATTTTACCGTAGAGACGAATAAAAGCATGTGAGTCGGTCCAAAAAGGTGCTGGTTGCGTCTTTTTGAGTGGTTGGTCGCTACCAAATGACACCACCGGGACCACCCTTGAATCATTACGATCGTGATGGACTACTTGTTTTCTCCGACCGCCGAACCGCGGTTATGACCACCGCCACATCTAAAATTTTCCCTCTTT...

CDS

Download CDS FASTA

2358 bp · TkA03G206130|TK1151|CDS

ATGCATCCTTTTTGCTGTGTTCCCGCCGATCATAATAATTCGATGCCTGCTACTCCCTCCTCCGCTGCCGCCCTGGGATCGGATTCTTCCAAGCACATAAATCCCGTTCATAAAGTTAACAACCACAACCATAACCACCACGTTACTTTCAATACGGCGTCGGATGCTGAACGGCAATCGACGATCAGGTTGACGAGTGGAGATCAGAGAGATGTGAAGATCAATGATCTAGTAGGGAGTGGGATATCAGGGATTTTGCA...

Protein

Download Protein FASTA

785 aa · TkA03G206130|TK1151|PROTEIN

MHPFCCVPADHNNSMPATPSSAAALGSDSSKHINPVHKVNNHNHNHHVTFNTASDAERQSTIRLTSGDQRDVKINDLVGSGISGILHKWVNYGKGWRPRWFVLQDGVLSYYKIHGPDKIVVSKVTEKGSRVIGDESFRRFSRHQSSVPSTDNSNHPRRKPVGEVHLKVSSIRESRSDDKRFSIFTGTKRLHLRADTRDDRIAWMEAFQAVKGMFPRMSNNELMAPIDRFTVSTDKLRQRLLQEGVSEAAIQDSEHIMRSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G206130`
TK1151 ID	TkA03G206130
OH-1004 ID	LXL04_007687
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G206130

Location Chr03:51725856-51732025 (+)

Description Similar to ORP1C: Oxysterol-binding protein-related protein 1C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g08180`	May be involved in the transport of sterols.	No verified direct reference in this release
`At2g31020`	May be involved in the transport of sterols.	No verified direct reference in this release
`At1g13170`	May be involved in the transport of sterols.	No verified direct reference in this release
`At4g22540`	May be involved in the transport of sterols.	No verified direct reference in this release
`At4g12460`	May be involved in the transport of sterols.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007687 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016020 membrane Cellular Component

GO:0032934 sterol binding Molecular Function

KEGG gene cross-reference

ath:AT1G13170

ath:AT4G08180

ath:AT4G12460

ath:AT4G22540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.515

Rank 1 · TkA03G206130 · TK1151

Cell membrane0.270

Rank 2 · TkA03G206130 · TK1151

Nucleus0.238

Rank 3 · TkA03G206130 · TK1151

Golgi apparatus0.153

Rank 4 · TkA03G206130 · TK1151

Endoplasmic reticulum0.090

Rank 5 · TkA03G206130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00169PH36-60 aa

PF15413PH_1142-70 aa

PF00169PH82-210 aa

PF15409PH_886-114 aa

PF15413PH_1188-208 aa

PF01237Oxysterol_BP94-105 aa

PF26655DUF821895-144 aa

PF15409PH_8162-211 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G206130	`PF00169`	PH	36	60	3.9e-12	47.3
TkA03G206130	`PF15413`	PH_11	42	70	3.5e-12	47.4
TkA03G206130	`PF00169`	PH	82	210	3.9e-12	47.3
TkA03G206130	`PF15409`	PH_8	86	114	5.8e-05	24.1
TkA03G206130	`PF15413`	PH_11	88	208	3.5e-12	47.4
TkA03G206130	`PF01237`	Oxysterol_BP	94	105	7.5e-133	443.6
TkA03G206130	`PF26655`	DUF8218	95	144	0.0059	17.3
TkA03G206130	`PF15409`	PH_8	162	211	5.8e-05	24.1
TkA03G206130	`PF21987`	YajR_YAM	231	255	0.18	12.3
TkA03G206130	`PF01237`	Oxysterol_BP	415	764	7.5e-133	443.6
TkA03G206130	`PF00169`	PH	733	745	3.9e-12	47.3
TkA03G206130	`PF26655`	DUF8218	739	753	0.0059	17.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L751`	Arabidopsis thaliana	sp\|Q8L751\|ORP1C_ARATH Oxysterol-binding protein-related protein 1C	72.800%	Swiss-Prot	High
`O80866`	Arabidopsis thaliana	sp\|O80866\|ORP1A_ARATH Oxysterol-binding protein-related protein 1A	72.500%	Swiss-Prot	High
`Q9SAF0`	Arabidopsis thaliana	sp\|Q9SAF0\|ORP1D_ARATH Oxysterol-binding protein-related protein 1D	62.700%	Swiss-Prot	High
`Q940Y1`	Arabidopsis thaliana	sp\|Q940Y1\|ORP2A_ARATH Oxysterol-binding protein-related protein 2A	55.700%	Swiss-Prot	High
`Q9SU36`	Arabidopsis thaliana	sp\|Q9SU36\|ORP2B_ARATH Oxysterol-binding protein-related protein 2B	55.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card