TkA03G203140 | RubberDandelionOmics

Gene overview

TkA03G203140

Reference: TK1151 Chr: Chr03 Coordinates: 51017123-51019650 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2191 bp · TkA03G203140|TK1151|cDNA

ATGATATTATTATTTTAGGGACATAAATCGTAGATTCATAATTGGAAGGGACGATTGTTGTAATTCGTTTCTGAAACCCTAGTTAGGCATATCTTCACATGGCTAAAACCCTTTGTCATTCCCGCGCTCTCTCTGGTTTATCTACAGCCAATTGCAGCACGTTTGACTGTGAACACGAAAGCTAGAAGAAAAAGAAATGGAGTAAGAGGGGTAAAGGTAATGGTTAAGAGTTATGCACAAGTTTTTACGTCGGAACCCTT...

CDS

Download CDS FASTA

1686 bp · TkA03G203140|TK1151|CDS

ATGCACAAGTTTTTACGTCGGAACCCTTGTTCAGGAGGCCCCATCCTCTGCTCCTCACCTGACATTTTTATCCCGATAGGGTTTAAGCAAAAAAATCCCACTTCATTTACCCCCTTGATGCCTTACGCCGCCACCGCATCCCACCTACGTTCTTCCGGTATGGCGACTGCCATAGGCGGTGGAAACGCTTCCTTTGCTTTTGGTAACAGTAGCACATGTTCGACTTCTCCTCGTTTAGCTTCCAGTTCTAGCTTCAGCTG...

Protein

Download Protein FASTA

561 aa · TkA03G203140|TK1151|PROTEIN

MHKFLRRNPCSGGPILCSSPDIFIPIGFKQKNPTSFTPLMPYAATASHLRSSGMATAIGGGNASFAFGNSSTCSTSPRLASSSSFSCRNCRCSVDNATAISSRAWAAFKENRSGSRVAWFHTSFSDKDVSVSALKSEDNSDSGGGDDEKPIKFNRRHRGSPVGGSNNAPPLLPGNPDLLRIPGVGPRNLRKLVENGIGAVAELKKIYKDKFFGKSNQKMVEFLRSSVGIVHRNHAESITTFIKESVDEELKDDHVNSNTQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G203140`
TK1151 ID	TkA03G203140
OH-1004 ID	LXL04_007664
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.822 / OH-1004 96.220 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G203140`
Location	Chr03:51017123-51019650 (-)
Description	Similar to DCK: Deoxycytidine kinase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007664` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006220 pyrimidine nucleotide metabolic process Biological Process GO:0009157 deoxyribonucleoside monophosphate biosynthetic process Biological Process GO:0032261 purine nucleotide salvage Biological Process GO:0043173 nucleotide salvage Biological Process GO:0046092 deoxycytidine metabolic process Biological Process GO:0106384 dGMP salvage Biological Process GO:1901293 nucleoside phosphate biosynthetic process Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	bta:530642 gga:770922 hsa:1633 mmu:13178 rno:79127 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.508

Rank 1 · TkA03G203140 · TK1151

Plastid0.411

Rank 2 · TkA03G203140 · TK1151

Nucleus0.093

Rank 3 · TkA03G203140 · TK1151

Cytoplasm0.045

Rank 4 · TkA03G203140 · TK1151

Cell membrane0.016

Rank 5 · TkA03G203140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25199nSTAND_NTPase5104-128 aa

PF14520HHH_5177-204 aa

PF16413Mlh1_C192-208 aa

PF25199nSTAND_NTPase5245-291 aa

PF01712dNK269-523 aa

PF13238AAA_18271-426 aa

PF02223Thymidylate_kin272-289 aa

PF13207AAA_17277-289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G203140	`PF25199`	nSTAND_NTPase5	104	128	0.15	12.6
TkA03G203140	`PF14520`	HHH_5	177	204	0.00022	22.3
TkA03G203140	`PF16413`	Mlh1_C	192	208	0.28	11.3
TkA03G203140	`PF25199`	nSTAND_NTPase5	245	291	0.15	12.6
TkA03G203140	`PF01712`	dNK	269	523	1.1e-49	169.7
TkA03G203140	`PF13238`	AAA_18	271	426	0.097	13.9
TkA03G203140	`PF02223`	Thymidylate_kin	272	289	0.064	13.7
TkA03G203140	`PF13207`	AAA_17	277	289	0.18	12.8
TkA03G203140	`PF02223`	Thymidylate_kin	396	441	0.064	13.7
TkA03G203140	`PF13207`	AAA_17	400	426	0.18	12.8
TkA03G203140	`PF18569`	Thioredoxin_16	469	508	0.1	13.5
TkA03G203140	`PF16413`	Mlh1_C	487	529	0.28	11.3
TkA03G203140	`PF02686`	GatC	511	540	0.03	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card