Gene Card
Gene overview
cDNA / CDS / Protein Sequences
360 bp · TkA03G194400|TK1151|cDNA
GGACAATTACATGGCTTGATTCTGTCACTAATGTTCCATTTAAGGGCAGAAAGGTCATTCATCTGTAATGACACTGGTTCATTAATCCAAGAACCTCCAAAACGTTTCCAAACTTACAAAAATGAAGACATAAAGTTTTCAGTGGAAGAACTTTCAGAAATCAAAAAAGTTGGAATAGGAAGTTTAAGGCTTTTAGGGTTTAATCCATTAAGTTGCTTGAAAGATTATTATAACTTAAAACCATCAACATTTGTGTTTCC...
330 bp · TkA03G194400|TK1151|CDS
ATGTTCCATTTAAGGGCAGAAAGGTCATTCATCTGTAATGACACTGGTTCATTAATCCAAGAACCTCCAAAACGTTTCCAAACTTACAAAAATGAAGACATAAAGTTTTCAGTGGAAGAACTTTCAGAAATCAAAAAAGTTGGAATAGGAAGTTTAAGGCTTTTAGGGTTTAATCCATTAAGTTGCTTGAAAGATTATTATAACTTAAAACCATCAACATTTGTGTTTCCTAGTGATGAGGAAGTGATAGGAAGCACTTG...
Protein
Download Protein FASTA110 aa · TkA03G194400|TK1151|PROTEIN
MFHLRAERSFICNDTGSLIQEPPKRFQTYKNEDIKFSVEELSEIKKVGIGSLRLLGFNPLSCLKDYYNLKPSTFVFPSDEEVIGSTCIFIALHRSMISLKRFAVAFYGSS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G194400 |
|---|---|
| TK1151 ID | TkA03G194400 |
| OH-1004 ID | LXL04_019346 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 44.177Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G194400 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:48859838-48860342 (+) | ||||||||||||
| Description | Similar to KU70: ATP-dependent DNA helicase 2 subunit KU70 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000723 telomere maintenance Biological Process GO:0006281 DNA repair Biological Process GO:0006303 double-strand break repair via nonhomologous end joining Biological Process GO:0006310 DNA recombination Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0009408 response to heat Biological Process GO:0034728 nucleosome organization Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0071480 cellular response to gamma radiation Biological Process GO:0000781 chromosome, telomeric region Cellular Component GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT1G16970 ath:AT2G13370 dosa:Os07g0184900 gga:395767 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02735Ku5-107 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G194400 | PF02735 | Ku | 5 | 107 | 3.5e-18 | 66.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.