TkA03G192730 | RubberDandelionOmics

Gene overview

TkA03G192730

Reference: TK1151 Chr: Chr03 Coordinates: 48499906-48503171 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1001 bp · TkA03G192730|TK1151|cDNA

AAATTGTTGATCGTTTTCATACGAACAAACTATTTGAAGGTTTTTCTAGAATACATATTTCAGCCGTCGTCGTGATGTAAAGAGAATACTCCAATGCTTCCTCCATAAAGCATAAAACGAAACTGTTTTTTTCTCTCTTACTTCCATTTCTTTACCCATCAACTTTCTTTCAATTCCCAAGCAAAAACGATGCTCAACCAAGGGTTTTTAGAAGATCAACAAATGGCGTTCTTTCCTTTTCCTGCAAACATGATTTCCCT...

CDS

Download CDS FASTA

600 bp · TkA03G192730|TK1151|CDS

ATGCTCAACCAAGGGTTTTTAGAAGATCAACAAATGGCGTTCTTTCCTTTTCCTGCAAACATGATTTCCCTTCCCCATCAAAACCAGAAAACTTTATCACCTTCTCATCCACTTCCACAACACTCTAAACCAGAACAGCATCTCGCTAATTCTCACTTTGGTCTTCCTTTGCAATCTTCAAATGCAAATTACTGGGCATGGGGGGATGTCGGTGAAATAATCAGTAACAAGATATTAGGGATGAGTAGTAGAGATGACCA...

Protein

Download Protein FASTA

199 aa · TkA03G192730|TK1151|PROTEIN

MLNQGFLEDQQMAFFPFPANMISLPHQNQKTLSPSHPLPQHSKPEQHLANSHFGLPLQSSNANYWAWGDVGEIISNKILGMSSRDDHHHLGVSGMKMKKLKSRRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDTCRVKKRVERLAEDPRMVITTYEGRHAHSPSLNEEDSEANSAKLNFWF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G192730`
TK1151 ID	TkA03G192730
OH-1004 ID	LXL04_007581
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G192730

Location Chr03:48499906-48503171 (-)

Description Similar to WRKY13: Probable WRKY transcription factor 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39410`	Transcription factor.	No verified direct reference in this release
`At2g44745`	Transcription factor.	No verified direct reference in this release
`At5g41570`	Transcription factor.	No verified direct reference in this release
`At1g69310`	Transcription factor.	No verified direct reference in this release
`At1g64000`	Transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007581 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1901141 regulation of lignin biosynthetic process Biological Process

GO:1904369 positive regulation of sclerenchyma cell differentiation Biological Process

GO:1990170 stress response to cadmium ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G64000

ath:AT1G69310

ath:AT2G44745

ath:AT4G39410

ath:AT5G41570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.977

Rank 1 · TkA03G192730 · TK1151

Cytoplasm0.071

Rank 2 · TkA03G192730 · TK1151

Cell membrane0.023

Rank 3 · TkA03G192730 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA03G192730 · TK1151

Plastid0.011

Rank 5 · TkA03G192730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106WRKY123-179 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G192730	`PF03106`	WRKY	123	179	6e-26	91.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVB7`	Arabidopsis thaliana	sp\|Q9SVB7\|WRK13_ARATH Probable WRKY transcription factor 13	76.900%	Swiss-Prot	Medium
`Q93WY4`	Arabidopsis thaliana	sp\|Q93WY4\|WRK12_ARATH Probable WRKY transcription factor 12	61.300%	Swiss-Prot	Medium
`Q9FFS3`	Arabidopsis thaliana	sp\|Q9FFS3\|WRK24_ARATH Probable WRKY transcription factor 24	65.100%	Swiss-Prot	Low
`Q9C983`	Arabidopsis thaliana	sp\|Q9C983\|WRK57_ARATH Probable WRKY transcription factor 57	65.400%	Swiss-Prot	Low
`Q8VWQ4`	Arabidopsis thaliana	sp\|Q8VWQ4\|WRK56_ARATH Probable WRKY transcription factor 56	53.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card