TkA03G186420 | RubberDandelionOmics

Gene overview

TkA03G186420

Reference: TK1151 Chr: Chr03 Coordinates: 46938217-46942660 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1267 bp · TkA03G186420|TK1151|cDNA

ATGCTTAGTCATCATGGGCGTTTCTGGTTTCTTGTACAGTTCGGGATCCGTTGTGCGGTTTGCGTGATTTCCCCAAAATGCCCTTTTGGATACGATTCTCAGACTTTCAAGATCGGCCCTTTTAGTTGCATAATATGCCAAGCCCTCATCTTCGAGTGTAACAGATGTGTCCCTAGTACTCACGTCTTTTGCAAAGCATGTATATCAAGATTCAGTGATTGTCCACTATGTGGTGTTGACATTGAGAAGATAGAAGCTGA...

CDS

Download CDS FASTA

957 bp · TkA03G186420|TK1151|CDS

ATGCTTAGTCATCATGGGCGTTTCTGGTTTCTTGTACAGTTCGGGATCCGTTGTGCGGTTTGCGTGATTTCCCCAAAATGCCCTTTTGGATACGATTCTCAGACTTTCAAGATCGGCCCTTTTAGTTGCATAATATGCCAAGCCCTCATCTTCGAGTGTAACAGATGTGTCCCTAGTACTCACGTCTTTTGCAAAGCATGTATATCAAGATTCAGTGATTGTCCACTATGTGGTGTTGACATTGAGAAGATAGAAGCTGA...

Protein

Download Protein FASTA

318 aa · TkA03G186420|TK1151|PROTEIN

MLSHHGRFWFLVQFGIRCAVCVISPKCPFGYDSQTFKIGPFSCIICQALIFECNRCVPSTHVFCKACISRFSDCPLCGVDIEKIEADTNLPSVVDGFIDGQVSISGEQKQLWLIVILCMNDMQAFRANNVESAKSRLSLCAQDIREQLETHLSYVHSWELFWVCLMVILKCSRAMGDGTSVVGYFDESVTFLSKVGTDDLEVTHTLSVSLNKIGDLKYYEGDLKAARDHYFRALDVRRNAIKDSSKAPSQVLDVAVSLAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G186420`
TK1151 ID	TkA03G186420
OH-1004 ID	LXL04_007521
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	81.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G186420

Location Chr03:46938217-46942660 (+)

Description Similar to NCA1: Protein NCA1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54360`	Has holdase chaperone activity that may fold catalase to a functional structure.	Catalase and NO CATALASE ACTIVITY1 promote autophagy-dependent cell death in Arabidopsis.2013 · DOI: 10.1105/tpc.113.117192 A chaperone function of NO CATALASE ACTIVITY1 is required to maintain catalase activity and for multiple stress responses in Arabidopsis.2015 · DOI: 10.1105/tpc.114.135095

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007521 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031398 positive regulation of protein ubiquitination Biological Process

GO:0031648 protein destabilization Biological Process

GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

GO:0044779 meiotic spindle checkpoint signaling Biological Process

GO:0044818 mitotic G2/M transition checkpoint Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G54360

dre:564271

mmu:231600

xla:734287

xtr:395009

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.545

Rank 1 · TkA03G186420 · TK1151

Nucleus0.296

Rank 2 · TkA03G186420 · TK1151

Mitochondrion0.113

Rank 3 · TkA03G186420 · TK1151

Peroxisome0.082

Rank 4 · TkA03G186420 · TK1151

Endoplasmic reticulum0.076

Rank 5 · TkA03G186420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13920zf-C3HC4_318-25 aa

PF13920zf-C3HC4_342-83 aa

PF26471DUF8146135-156 aa

PF13516LRR_6205-215 aa

PF13424TPR_12206-238 aa

PF00515TPR_1209-238 aa

PF13516LRR_6229-244 aa

PF13424TPR_12255-286 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G186420	`PF13920`	zf-C3HC4_3	18	25	0.0058	17.1
TkA03G186420	`PF13920`	zf-C3HC4_3	42	83	0.0058	17.1
TkA03G186420	`PF26471`	DUF8146	135	156	0.14	13.1
TkA03G186420	`PF13516`	LRR_6	205	215	0.11	13.3
TkA03G186420	`PF13424`	TPR_12	206	238	0.0089	16.9
TkA03G186420	`PF00515`	TPR_1	209	238	0.049	14.2
TkA03G186420	`PF13516`	LRR_6	229	244	0.11	13.3
TkA03G186420	`PF13424`	TPR_12	255	286	0.0089	16.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2V1`	Arabidopsis thaliana	sp\|Q9M2V1\|NCA1_ARATH Protein NCA1	56.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card