TkA03G181060 | RubberDandelionOmics

Gene overview

TkA03G181060

Reference: TK1151 Chr: Chr03 Coordinates: 45660661-45663624 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1541 bp · TkA03G181060|TK1151|cDNA

TATTAATAGTAATATTACAAAGAAAACATAAACCAAACATTCGCAATTTCGCATGATCCATAGTCCCATACTACCCCTAGGATAAAGTTGATACGAGAATCTATGGGAAGAGCACAATAGCGGGAGAACGCGAACAGAAATTAAGCACAATCCTCGAGGAATTCGAATAAGGAAGCAATACATTCCTGTGTTCTTTCTCTTTTAACATCTTTCCCCATGGCTTTGTCTGCCTCCTCCACCGGCCGCGCAATCTCCTCCGT...

CDS

Download CDS FASTA

963 bp · TkA03G181060|TK1151|CDS

ATGGCTTTGTCTGCCTCCTCCACCGGCCGCGCAATCTCCTCCGTAGCCATCTCTTATTCACCATTATTGGGTTTTCTTAAACCAAACCATCAACAAAATCAGATAAGTTATGGGTTTAACAGCAAGTACAGCTCCCTGGCCATCAATTGTTCCTCTTCTGAAATGGGTCGCTCTCCAGATTCCAGGACGTTTAGCTTGAATGAAAATGGCAAAGCCAGAGGTCCCGTGAAGTGGCAAAGGGTGCTTCTTAAAGTAAGTGG...

Protein

Download Protein FASTA

320 aa · TkA03G181060|TK1151|PROTEIN

MALSASSTGRAISSVAISYSPLLGFLKPNHQQNQISYGFNSKYSSLAINCSSSEMGRSPDSRTFSLNENGKARGPVKWQRVLLKVSGEALAGDGEQNIDPKVTMAIAREVADVTRLGIEVAIVVGGGNIFRGASWAGSSGLDRSSADYIGMLATVMNAIYLQATMESIGIPTRVQTAFRMSEVAEPYIRRRAVRHLEKGRVVIFAAGTGNPFFTTDTAAALRCAEINAEVVLKATNVDGVYDEDPRINPKARLLDSLTYQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G181060`
TK1151 ID	TkA03G181060
OH-1004 ID	LXL04_007477
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G181060

Location Chr03:45660661-45663624 (-)

Description Similar to pyrH: Uridylate kinase (Trichodesmium erythraeum (strain IMS101)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18680`	Catalyzes the reversible phosphorylation of UMP to UDP.	A protein related to prokaryotic UMP kinases is involved in psaA/B transcript accumulation in Arabidopsis.2009 · DOI: 10.1007/s11103-008-9433-2 PUMPKIN, the Sole Plastid UMP Kinase, Associates with Group II Introns and Alters Their Metabolism.2019 · DOI: 10.1104/pp.18.00687

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007477 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006225 UDP biosynthetic process Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0031425 chloroplast RNA processing Biological Process

GO:0042548 regulation of photosynthesis, light reaction Biological Process

GO:0044210 'de novo' CTP biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0033862 UMP kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G18680

cya:CYA_2421

cyb:CYB_2292

syn:sll0144

ter:Tery_3779

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.973

Rank 1 · TkA03G181060 · TK1151

Mitochondrion0.030

Rank 2 · TkA03G181060 · TK1151

Nucleus0.027

Rank 3 · TkA03G181060 · TK1151

Cytoplasm0.019

Rank 4 · TkA03G181060 · TK1151

Cell membrane0.015

Rank 5 · TkA03G181060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00696AA_kinase80-289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G181060	`PF00696`	AA_kinase	80	289	1.2e-37	130.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSA9`	Arabidopsis thaliana	sp\|Q9LSA9\|PUMPK_ARATH Uridylate kinase PUMPKIN, chloroplastic	79.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card