TkA03G180750 | RubberDandelionOmics

Gene overview

TkA03G180750

Reference: TK1151 Chr: Chr03 Coordinates: 45590070-45596378 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2586 bp · TkA03G180750|TK1151|cDNA

CTAACCATCACAGCTCAGAAGCGAACCGACACTTTGCTTTTGGGTTTTGGTTGGTGTGGAAAAAAATCTAGGGAAATGGGTAGTCTTGGTGTGTTGAGAAATACGACAATGGTGTGTGTGCCATTGATGAGGCATTCCGTCGAACAGATGGTGGGTGATATGTATCAGGCGAAGATTGATGGTGCAGACCTAGTCGAACTCAGGCTTGATTGCTTGAAGGAGTTCGACGCTCAAAGAGATCTCCAGACTCTTCTTCGCAA...

CDS

Download CDS FASTA

1560 bp · TkA03G180750|TK1151|CDS

ATGGGTAGTCTTGGTGTGTTGAGAAATACGACAATGGTGTGTGTGCCATTGATGAGGCATTCCGTCGAACAGATGGTGGGTGATATGTATCAGGCGAAGATTGATGGTGCAGACCTAGTCGAACTCAGGCTTGATTGCTTGAAGGAGTTCGACGCTCAAAGAGATCTCCAGACTCTTCTTCGCAATAAACCACTCCCGGTTGCCGTCGTCTACCGGCCAAAATGGGAGGGTGGTTTATACGATGGCGATGAAAACTCAAG...

Protein

Download Protein FASTA

519 aa · TkA03G180750|TK1151|PROTEIN

MGSLGVLRNTTMVCVPLMRHSVEQMVGDMYQAKIDGADLVELRLDCLKEFDAQRDLQTLLRNKPLPVAVVYRPKWEGGLYDGDENSRLEALVLARDLGAEYVDFELQVASGIMEKRKLNQRSNCKIIVSCFVDGVTSLKEDLSHLLTRMQSTGADIIKLVTNATDITELSRIFHLLSHCQVPLIAYSTGERGLISQLLGPKFGGVFVYGSIEGNLVPGLPTLASLREAYGVENIDADTKVFGLISKPVSHSKGPILHNPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G180750`
TK1151 ID	TkA03G180750
OH-1004 ID	LXL04_007476
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G180750

Location Chr03:45590070-45596378 (-)

Description Similar to EMB3004: Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06350`	Bifunctional dehydroquinate dehydratase-shikimate dehydrogenase enzyme that catalyzes two steps in the chorismate biosynthesis pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007476 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008652 amino acid biosynthetic process Biological Process

GO:0009073 aromatic amino acid family biosynthetic process Biological Process

GO:0009423 chorismate biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0019632 shikimate metabolic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003855 3-dehydroquinate dehydratase activity Molecular Function

GO:0004764 shikimate 3-dehydrogenase (NADP+) activity Molecular Function

GO:0050661 NADP binding Molecular Function

KEGG gene cross-reference

ath:AT3G06350

bcb:BCB4264_A4454

bce:BC4331

bwe:BcerKBAB4_4185

mka:MK0117

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.533

Rank 1 · TkA03G180750 · TK1151

Nucleus0.218

Rank 2 · TkA03G180750 · TK1151

Plastid0.214

Rank 3 · TkA03G180750 · TK1151

Cell membrane0.074

Rank 4 · TkA03G180750 · TK1151

Peroxisome0.072

Rank 5 · TkA03G180750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01487DHquinase_I13-233 aa

PF08501Shikimate_dh_N243-323 aa

PF19386DUF5961299-332 aa

PF18317SDH_C337-351 aa

PF028262-Hacid_dh_C344-405 aa

PF01488Shikimate_DH366-421 aa

PF00670AdoHcyase_NAD366-413 aa

PF01262AlaDh_PNT_C370-416 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G180750	`PF01487`	DHquinase_I	13	233	5.8e-57	194.0
TkA03G180750	`PF08501`	Shikimate_dh_N	243	323	1e-23	84.1
TkA03G180750	`PF19386`	DUF5961	299	332	0.065	14.1
TkA03G180750	`PF18317`	SDH_C	337	351	6.6e-08	32.9
TkA03G180750	`PF02826`	2-Hacid_dh_C	344	405	0.15	12.1
TkA03G180750	`PF01488`	Shikimate_DH	366	421	0.019	15.7
TkA03G180750	`PF00670`	AdoHcyase_NAD	366	413	0.03	15.1
TkA03G180750	`PF01262`	AlaDh_PNT_C	370	416	0.048	13.8
TkA03G180750	`PF18317`	SDH_C	486	516	6.6e-08	32.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SQT8`	Arabidopsis thaliana	sp\|Q9SQT8\|DHQSD_ARATH Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic	51.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card