TkA03G162010 | RubberDandelionOmics

Gene overview

TkA03G162010

Reference: TK1151 Chr: Chr03 Coordinates: 41082790-41084663 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

820 bp · TkA03G162010|TK1151|cDNA

TTTGAAGTCCGTCAAAAACCACTCAATCGCTTTCAAGGACGAATTTATAATTCATGCCCTCACGTTCTCATACACGCTAACAAGTATGGCTAAAACCTGTATATGGGGCGCACATCTCCGGCCTTTACGTTTACTACTTCCACTTTCAAATTCAATTCTTTAAAACCAAAACCGATCATTTGAAATCTATTTAATTACAATACTACTCGAGCTTACAGATTTCAATGGCGAAACCACGAAGATCTTGGTTTGGTGTTGTA...

CDS

Download CDS FASTA

408 bp · TkA03G162010|TK1151|CDS

ATGGCGAAACCACGAAGATCTTGGTTTGGTGTTGTACGTAGAAAGTTTTTCCGGCCATCTTTACGTCCGTCGGAGACCATCATTGTCCTCCACACCAACAATACAACCTTCTCTCAAGAACAACCACCTCCACCACCACCATCAACCACCACCGTAACAGAAGAAAATGTTTGTGACACCCCTTTAGTCAAAGAGATGGCCGCAGCCACTAAAATCCAAGCTTGCTTTCGACGTCACCTTGCACAGAGAGCGTATAAGGC...

Protein

Download Protein FASTA

135 aa · TkA03G162010|TK1151|PROTEIN

MAKPRRSWFGVVRRKFFRPSLRPSETIIVLHTNNTTFSQEQPPPPPPSTTTVTEENVCDTPLVKEMAAATKIQACFRRHLAQRAYKALRSLVKLQAVVRGAYVRRQSRIALECMHALARLQVVVRARQLQLITSN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G162010`
TK1151 ID	TkA03G162010
OH-1004 ID	LXL04_026618
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	55.700
Protein coverage (%)	TK1151 45.185 / OH-1004 17.039 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G162010

Location Chr03:41082790-41084663 (-)

Description Similar to IQD14: Protein IQ-DOMAIN 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51380`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g49260`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	Calcium channels activated by hydrogen peroxide mediate abscisic acid signalling in guard cells.2000 · DOI: 10.1038/35021067 A defined range of guard cell calcium oscillation parameters encodes stomatal movements.2001 · DOI: 10.1038/35082575 CO(2) signaling in guard cells: calcium sensitivity response modulation, a Ca(2+)-independent phase, and CO(2) insensitivity of the gca2 mutant.2006 · DOI: 10.1073/pnas.0602225103 Combinatorial interactions of multiple cis-elements regulating the induction of the Arabidopsis XERO2 dehydrin gene by abscisic acid and cold.2008 · DOI: 10.1111/j.1365-313x.2007.03399.x Calcium elevation-dependent and attenuated resting calcium-dependent abscisic acid induction of stomatal closure and abscisic acid-induced enhancement of calcium sensitivities of S-type anion and inward-rectifying K channels in Arabidopsis guard cells.2009 · DOI: 10.1111/j.1365-313x.2009.03872.x
`At1g17480`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At5g13460`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g59690`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026618 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0055074 calcium ion homeostasis Biological Process

GO:0071244 cellular response to carbon dioxide Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G01110

ath:AT3G49260

ath:AT3G49380

ath:AT4G00820

ath:AT4G10640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.398

Rank 1 · TkA03G162010 · TK1151

Cytoplasm0.370

Rank 2 · TkA03G162010 · TK1151

Nucleus0.344

Rank 3 · TkA03G162010 · TK1151

Endoplasmic reticulum0.059

Rank 4 · TkA03G162010 · TK1151

Plastid0.039

Rank 5 · TkA03G162010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00612IQ12-16 aa

PF12355Dscam_C33-89 aa

PF00612IQ67-86 aa

PF00612IQ89-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G162010	`PF00612`	IQ	12	16	3.8e-05	23.8
TkA03G162010	`PF12355`	Dscam_C	33	89	0.0023	19.5
TkA03G162010	`PF00612`	IQ	67	86	3.8e-05	23.8
TkA03G162010	`PF00612`	IQ	89	106	3.8e-05	23.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD11`	Arabidopsis thaliana	sp\|Q9SD11\|IQD20_ARATH Protein IQ-DOMAIN 20	77.300%	Swiss-Prot	Low
`Q9ASW3`	Arabidopsis thaliana	sp\|Q9ASW3\|IQD21_ARATH Protein IQ-DOMAIN 21	52.200%	Swiss-Prot	Low
`Q2NND9`	Arabidopsis thaliana	sp\|Q2NND9\|IQD7_ARATH Protein IQ-DOMAIN 7	47.100%	Swiss-Prot	Medium
`Q9LYR0`	Arabidopsis thaliana	sp\|Q9LYR0\|IQD11_ARATH Protein IQ-DOMAIN 11	44.100%	Swiss-Prot	Medium
`Q9M199`	Arabidopsis thaliana	sp\|Q9M199\|IQD13_ARATH Protein IQ-DOMAIN 13	45.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card