TkA03G159040 | RubberDandelionOmics

Gene overview

TkA03G159040

Reference: TK1151 Chr: Chr03 Coordinates: 40294361-40295451 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · TkA03G159040|TK1151|cDNA

ATGCCATGGATGATTTCAGTAATCCAAGAGTTCAGGTTAGTAGTGCTCTCTATGCATATATATGCACATGCTGCTTCAACAGTGTTGAATTTCACTGAGAACTGTACTCCTGATATCTTGACACCTTACCTAGATGGAATAGTGAGCAAACTGCTTGTGTTATTACATAACGGTAAACAAATGGTTCAAGAAGGGGCCTTGACTGCTCTAGCATCAGAACAATTCCAAAAGTATTATGAAGCAATTATGCCCTACTTGAA...

CDS

Download CDS FASTA

480 bp · TkA03G159040|TK1151|CDS

ATGCCATGGATGATTTCAGTAATCCAAGAGTTCAGGTTAGTAGTGCTCTCTATGCATATATATGCACATGCTGCTTCAACAGTGTTGAATTTCACTGAGAACTGTACTCCTGATATCTTGACACCTTACCTAGATGGAATAGTGAGCAAACTGCTTGTGTTATTACATAACGGTAAACAAATGGTTCAAGAAGGGGCCTTGACTGCTCTAGCATCAGAACAATTCCAAAAGTATTATGAAGCAATTATGCCCTACTTGAA...

Protein

Download Protein FASTA

159 aa · TkA03G159040|TK1151|PROTEIN

MPWMISVIQEFRLVVLSMHIYAHAASTVLNFTENCTPDILTPYLDGIVSKLLVLLHNGKQMVQEGALTALASEQFQKYYEAIMPYLKAILVNANDKANRMLRAKAMECISLVGMAVGKEKFRDDAKQVMEVLMSLQGSQMETDDPTTSYMLQVFSPCSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G159040`
TK1151 ID	TkA03G159040
OH-1004 ID	LXL04_019614
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.400
Protein coverage (%)	TK1151 84.277 / OH-1004 73.158 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G159040`
Location	Chr03:40294361-40295451 (+)
Description	Similar to IPO5: Importin-5
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019614` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002753 cytoplasmic pattern recognition receptor signaling pathway Biological Process GO:0006406 mRNA export from nucleus Biological Process GO:0006606 protein import into nucleus Biological Process GO:0006607 NLS-bearing protein import into nucleus Biological Process GO:0006610 ribosomal protein import into nucleus Biological Process GO:0007088 regulation of mitotic nuclear division Biological Process GO:0042307 positive regulation of protein import into nucleus Biological Process GO:0045786 negative regulation of cell cycle Biological Process GO:0060188 regulation of protein desumoylation Biological Process GO:0071230 cellular response to amino acid stimulus Biological Process GO:0005634 nucleus Cellular Component GO:0005635 nuclear envelope Cellular Component
KEGG gene cross-reference	hsa:26953 hsa:3843 mmu:70572 sce:YMR308C spo:2539387 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.509

Rank 1 · TkA03G159040 · TK1151

Nucleus0.445

Rank 2 · TkA03G159040 · TK1151

Extracellular0.083

Rank 3 · TkA03G159040 · TK1151

Endoplasmic reticulum0.080

Rank 4 · TkA03G159040 · TK1151

Cell membrane0.073

Rank 5 · TkA03G159040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23271HEAT_GCN122-71 aa

PF13513HEAT_EZ24-71 aa

PF25574TPR_IMB132-57 aa

PF00514Arm46-71 aa

PF13513HEAT_EZ62-110 aa

PF05004IFRD66-147 aa

PF23271HEAT_GCN166-138 aa

PF09361Phasin_266-137 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G159040	`PF23271`	HEAT_GCN1	22	71	0.0081	17.0
TkA03G159040	`PF13513`	HEAT_EZ	24	71	6.9e-07	30.4
TkA03G159040	`PF25574`	TPR_IMB1	32	57	3e-05	23.6
TkA03G159040	`PF00514`	Arm	46	71	0.0048	17.6
TkA03G159040	`PF13513`	HEAT_EZ	62	110	6.9e-07	30.4
TkA03G159040	`PF05004`	IFRD	66	147	0.00063	19.5
TkA03G159040	`PF23271`	HEAT_GCN1	66	138	0.0081	17.0
TkA03G159040	`PF09361`	Phasin_2	66	137	0.019	15.9
TkA03G159040	`PF01417`	ENTH	66	144	0.038	14.7
TkA03G159040	`PF25574`	TPR_IMB1	72	144	3e-05	23.6
TkA03G159040	`PF00763`	THF_DHG_CYH	72	132	0.16	12.9
TkA03G159040	`PF06122`	TraH	74	157	0.072	13.2
TkA03G159040	`PF13513`	HEAT_EZ	101	140	6.9e-07	30.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card