RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G157180
Reference: TK1151 Chr: Chr03 Coordinates: 39867924-39870687 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1942 bp · TkA03G157180|TK1151|cDNA

CTTTTTACAGGAGAGATATATATAGAACAGAAAGGGAGAGTGAGATTTCTCTGGAGAGGAAACTTCCGTCAACCCTCTCTTCTTCACTCTTTGATCATCTCTCCTTCACGAGAATTTGATCAAACAAATCAATTCAACCAGAAAAAAAAAGATATACGTATACGTAATCGTATACGTATCCACGGGGTTTGGATATTTGATTGATCTACAGATCTAACACATGTAAACCCCACATGGGTTTCCTTTAATTTCTTCAGATC...

CDS

Download CDS FASTA

1158 bp · TkA03G157180|TK1151|CDS

ATGTTATCAAGATTGATAAATTTTCTCAAAGCCTGCTGGCGACCTTCAGATGGTTTGGATTCAGCAGGCAGGCAGGAAGGTCTTCTTTGGTATAAAGACATCGGTCACCATCTAAATGGCGAGTACTCCATGGCTGTGGTCCAAGCCAACATGTTGCTTGAAGATCAAAGCCAAATTGAATCAGGTCCATTAAGCTTCCATGAATCTGGTCCATTTGGAACCTTTGTAGGTGTATACGATGGTCATGGTGGTCCTGAAAC...

Protein

Download Protein FASTA

385 aa · TkA03G157180|TK1151|PROTEIN

MLSRLINFLKACWRPSDGLDSAGRQEGLLWYKDIGHHLNGEYSMAVVQANMLLEDQSQIESGPLSFHESGPFGTFVGVYDGHGGPETSRYVNDNLFHNLKKITSEQHTISVDVIKKAFQATEEGFSSIVAKQWTVKPQLASVGTCCLTGVISNGTLYIANVGDSRAVLGRTVKATGEVLAVQLSVEHNASIESIRQELHSMHPDDPQIVILKHNVWRVKGLIQISRSIGDVYLKKAEFNREPLYAKFRLRDPIKKPILSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G157180
TK1151 IDTkA03G157180
OH-1004 IDLXL04_007328
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 91.885
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G157180
LocationChr03:39867924-39870687 (+)
DescriptionSimilar to Os06g0717800: Probable protein phosphatase 2C 60
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g66080 May dephosphorylate and repress plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness. No verified direct reference in this release
At3g51370 May dephosphorylate and repress plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness. No verified direct reference in this release
At4g38520 Dephosphorylates and represses plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0717800 Probable protein phosphatase 2C 60. No verified direct reference in this release
Os03g0137200 Probable protein phosphatase 2C 28. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_007328 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:1900036 positive regulation of cellular response to heat Biological Process
GO:1902531 regulation of intracellular signal transduction Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
GO:0004722 protein serine/threonine phosphatase activity Molecular Function
GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference
ath:AT3G51370
ath:AT4G38520
ath:AT5G66080
dosa:Os03g0137200
dosa:Os06g0717800
osa:4331548
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.307
Rank 1 · TkA03G157180 · TK1151
Cell membrane0.287
Rank 2 · TkA03G157180 · TK1151
Nucleus0.212
Rank 3 · TkA03G157180 · TK1151
Endoplasmic reticulum0.148
Rank 4 · TkA03G157180 · TK1151
Mitochondrion0.111
Rank 5 · TkA03G157180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481PP2C74-318 aa
PF13672PP2C_278-293 aa
PF07228SpoIIE145-171 aa
PF22771ToxA_barrel191-219 aa
PF07228SpoIIE271-347 aa
PF21994AGAO-like_N2292-341 aa
PF22771ToxA_barrel320-346 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G157180PF00481PP2C743182.5e-39136.2
TkA03G157180PF13672PP2C_2782930.0009219.6
TkA03G157180PF07228SpoIIE1451710.04914.3
TkA03G157180PF22771ToxA_barrel1912190.212.9
TkA03G157180PF07228SpoIIE2713470.04914.3
TkA03G157180PF21994AGAO-like_N22923410.09713.6
TkA03G157180PF22771ToxA_barrel3203460.212.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FKX4Arabidopsis thalianasp|Q9FKX4|P2C79_ARATH Probable protein phosphatase 2C 7970.800%Swiss-ProtHigh
Q9SD12Arabidopsis thalianasp|Q9SD12|P2C46_ARATH Probable protein phosphatase 2C 4671.300%Swiss-ProtHigh
Q5PNS9Arabidopsis thalianasp|Q5PNS9|P2C64_ARATH Probable protein phosphatase 2C 6468.100%Swiss-ProtHigh
Q5Z8P0Oryza sativa subsp. japonicasp|Q5Z8P0|P2C60_ORYSJ Probable protein phosphatase 2C 6073.900%Swiss-ProtHigh
Q10S32Oryza sativa subsp. japonicasp|Q10S32|P2C28_ORYSJ Probable protein phosphatase 2C 2868.700%Swiss-ProtHigh

JBrowse

View in Genome Browser