TkA03G145280 | RubberDandelionOmics

Gene overview

TkA03G145280

Reference: TK1151 Chr: Chr03 Coordinates: 37009824-37010598 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

489 bp · TkA03G145280|TK1151|cDNA

ATGCCAGGTGCCGACTACCATCTCACCAACCTTCTCGGACTCTTCCCCTTCAGTCAAGCGGTTCATGATGTTCCACCAAGCCTGTTCAGGTGGCGGAATGGCCTTCGACTTGCAAAAGACCTTTCTGAAAACAATAAAGGCTCACGTGTACTTGTTGTATGCGCCGAGATTTCCGCCGCCTATTTCCATGCACCAAATGAGAACGACATCGACTCTCTCGTTGGCCAGTCTCTCTTTGGAGATGGAGCTGGTGCGATCAT...

CDS

Download CDS FASTA

489 bp · TkA03G145280|TK1151|CDS

ATGCCAGGTGCCGACTACCATCTCACCAACCTTCTCGGACTCTTCCCCTTCAGTCAAGCGGTTCATGATGTTCCACCAAGCCTGTTCAGGTGGCGGAATGGCCTTCGACTTGCAAAAGACCTTTCTGAAAACAATAAAGGCTCACGTGTACTTGTTGTATGCGCCGAGATTTCCGCCGCCTATTTCCATGCACCAAATGAGAACGACATCGACTCTCTCGTTGGCCAGTCTCTCTTTGGAGATGGAGCTGGTGCGATCAT...

Protein

Download Protein FASTA

162 aa · TkA03G145280|TK1151|PROTEIN

MPGADYHLTNLLGLFPFSQAVHDVPPSLFRWRNGLRLAKDLSENNKGSRVLVVCAEISAAYFHAPNENDIDSLVGQSLFGDGAGAIIVGSELDLRASRHVLSEYGNLASASVLFVIEEMRKTSIQEGKKSTGEGLDWGVLLGFGPGLTVEAVVLCSLPVSAL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G145280`
TK1151 ID	TkA03G145280
OH-1004 ID	LXL04_007239
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	55.100
Protein coverage (%)	TK1151 100.000 / OH-1004 64.484 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G145280`
Location	Chr03:37009824-37010598 (+)
Description	Similar to CHS3: Chalcone synthase 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007239` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009813 flavonoid biosynthetic process Biological Process GO:0030639 polyketide biosynthetic process Biological Process GO:0016210 naringenin-chalcone synthase activity Molecular Function GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function GO:0042803 protein homodimerization activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.309

Rank 1 · TkA03G145280 · TK1151

Peroxisome0.204

Rank 2 · TkA03G145280 · TK1151

Extracellular0.186

Rank 3 · TkA03G145280 · TK1151

Nucleus0.111

Rank 4 · TkA03G145280 · TK1151

Mitochondrion0.081

Rank 5 · TkA03G145280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00195Chal_sti_synt_N1-91 aa

PF08545ACP_syn_III34-93 aa

PF02797Chal_sti_synt_C93-158 aa

PF08541ACP_syn_III_C99-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G145280	`PF00195`	Chal_sti_synt_N	1	91	3.7e-28	99.2
TkA03G145280	`PF08545`	ACP_syn_III	34	93	2.9e-07	31.0
TkA03G145280	`PF02797`	Chal_sti_synt_C	93	158	2.6e-25	89.9
TkA03G145280	`PF08541`	ACP_syn_III_C	99	154	0.00013	22.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card