TkA03G142580 | RubberDandelionOmics

Gene overview

TkA03G142580

Reference: TK1151 Chr: Chr03 Coordinates: 36377297-36380909 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1796 bp · TkA03G142580|TK1151|cDNA

GAAAATAATTGGAAAACCGAGATTTTAGATATGCATTTCATTTTTTCACTTAACATTTTTGTTTTATCTTGCAACTTGCGGTATGATGACATGTACCTGAAGTCCTGAACAGTGTTGATGTAAATAAAATACAGGTGGCTGTTGCATGAGAGCAGAAAGGAGTCGGGACCATGGATGACGATCAGGGGATGCGACGGAGCGTGGAGGAGCTCCGGCAGACGTTTAAGAGCGGCAAAACTAGAGGCGTTGATTGGAGAAAA...

CDS

Download CDS FASTA

1452 bp · TkA03G142580|TK1151|CDS

ATGGATGACGATCAGGGGATGCGACGGAGCGTGGAGGAGCTCCGGCAGACGTTTAAGAGCGGCAAAACTAGAGGCGTTGATTGGAGAAAAGCACAGCTTCGAGCAATTCTCAGACTGATTGAGGAAAACGAAGATAACCTCTTTCAATTACTTCAGTCCGAACTCGGAAAACACCCTGTTGAATCATATCGCGATGAAATTGGTATAGTGAAGAAATCAGTTGACCAAGCGTTGAGCTGCATTGACCAATGGATGTCCCC...

Protein

Download Protein FASTA

483 aa · TkA03G142580|TK1151|PROTEIN

MDDDQGMRRSVEELRQTFKSGKTRGVDWRKAQLRAILRLIEENEDNLFQLLQSELGKHPVESYRDEIGIVKKSVDQALSCIDQWMSPKKGWLPLLFFPASRSMLPEPLGVILILGSWNFPISLILDPLIGAISAGNTVMLKPSELAPNCASFLAKIIPLYLDPKAIKVIEGGKEISKQLLEYKWDKIFFTGSTKVGKLVMAAAAKHLTPVTLELGGKCPAIFDSLPNSDMKVAAKRVASGKWGACCGQACIGVDYMLVEQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G142580`
TK1151 ID	TkA03G142580
OH-1004 ID	LXL04_007228
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G142580

Location Chr03:36377297-36380909 (-)

Description Similar to ALDH3F1: Aldehyde dehydrogenase family 3 member F1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36250`	Aldehyde dehydrogenase family 3 member F1.	No verified direct reference in this release
`At1g44170`	Involved in oxidative stress tolerance by detoxifying reactive aldehydes derived from lipid peroxidation.	Engineering the nucleotide coenzyme specificity and sulfhydryl redox sensitivity of two stress-responsive aldehyde dehydrogenase isoenzymes of Arabidopsis thaliana.2011 · DOI: 10.1042/bj20101337
`At4g34240`	Involved in oxidative stress tolerance by detoxifying reactive aldehydes derived from lipid peroxidation.	Engineering the nucleotide coenzyme specificity and sulfhydryl redox sensitivity of two stress-responsive aldehyde dehydrogenase isoenzymes of Arabidopsis thaliana.2011 · DOI: 10.1042/bj20101337

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007228 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006081 aldehyde metabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0009269 response to desiccation Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0046458 hexadecanal metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT1G44170

ath:AT4G34240

ath:AT4G36250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.267

Rank 1 · TkA03G142580 · TK1151

Endoplasmic reticulum0.264

Rank 2 · TkA03G142580 · TK1151

Mitochondrion0.180

Rank 3 · TkA03G142580 · TK1151

Peroxisome0.159

Rank 4 · TkA03G142580 · TK1151

Lysosome / Vacuole0.082

Rank 5 · TkA03G142580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00171Aldedh9-438 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G142580	`PF00171`	Aldedh	9	438	4.8e-79	266.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q70E96`	Arabidopsis thaliana	sp\|Q70E96\|AL3F1_ARATH Aldehyde dehydrogenase family 3 member F1	61.200%	Swiss-Prot	High
`Q70DU8`	Arabidopsis thaliana	sp\|Q70DU8\|AL3H1_ARATH Aldehyde dehydrogenase family 3 member H1	49.400%	Swiss-Prot	Medium
`Q8W033`	Arabidopsis thaliana	sp\|Q8W033\|AL3I1_ARATH Aldehyde dehydrogenase family 3 member I1, chloroplastic	47.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card