TkA03G134210 | RubberDandelionOmics

Gene overview

TkA03G134210

Reference: TK1151 Chr: Chr03 Coordinates: 34398537-34399371 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

768 bp · TkA03G134210|TK1151|cDNA

ATGATCGATGAGCTCAAACAGGCTTTGATTCCTGAACGGTTTGGAGATTCAACCTATTTAATAGATTCAATTGCTGTGGCTGAATTTGGGGGTAGATTGATTCATGAGTTACGTGGAAAAGGCAGCCATGGAAGACCTTCAGGATCACTCGCTGTTCAACGCGAGCCAATTGATCGAGCAGCCATTGAAGAAGCAATTAAGGTCGTGACTTGTTTCTATGAAGATAAAACCGAATGGGCTACCGGCCCCGATTTTGACCT...

CDS

Download CDS FASTA

768 bp · TkA03G134210|TK1151|CDS

ATGATCGATGAGCTCAAACAGGCTTTGATTCCTGAACGGTTTGGAGATTCAACCTATTTAATAGATTCAATTGCTGTGGCTGAATTTGGGGGTAGATTGATTCATGAGTTACGTGGAAAAGGCAGCCATGGAAGACCTTCAGGATCACTCGCTGTTCAACGCGAGCCAATTGATCGAGCAGCCATTGAAGAAGCAATTAAGGTCGTGACTTGTTTCTATGAAGATAAAACCGAATGGGCTACCGGCCCCGATTTTGACCT...

Protein

Download Protein FASTA

255 aa · TkA03G134210|TK1151|PROTEIN

MIDELKQALIPERFGDSTYLIDSIAVAEFGGRLIHELRGKGSHGRPSGSLAVQREPIDRAAIEEAIKVVTCFYEDKTEWATGPDFDLLEKVHEAAEELQMLIDEKSYHLVSATAKQKHMDDAAHEEEEEHSNETPRLKQSHTSKNIDRHMTNMSMNLPWAGSCEEDALKMQLQWSSRLSFVGEAILNEREVRTYESASALSLANFTSSLFEFVARLQNLLNSFKELSEKAKFTDTKKPLEKEEGGFWTRLMGFNN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G134210`
TK1151 ID	TkA03G134210
OH-1004 ID	LXL04_005812
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.900
Protein coverage (%)	TK1151 92.157 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G134210

Location Chr03:34398537-34399371 (-)

Description Similar to ALMT6: Aluminum-activated malate transporter 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02730`	Involved in stem and root growth.	Disruption of ATCSLD5 results in reduced growth, reduced xylan and homogalacturonan synthase activity and altered xylan occurrence in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03281.x
`At2g17470`	Malate transporter.	No verified direct reference in this release
`At1g68600`	Malate transporter.	No verified direct reference in this release
`At1g25480`	Malate transporter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0555600`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005812 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000919 cell plate assembly Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009625 response to insect Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0015743 malate transport Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0048367 shoot system development Biological Process

GO:0071423 malate transmembrane transport Biological Process

KEGG gene cross-reference

ath:AT1G02730

ath:AT1G25480

ath:AT1G68600

ath:AT2G17470

ath:AT3G18440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.476

Rank 1 · TkA03G134210 · TK1151

Nucleus0.389

Rank 2 · TkA03G134210 · TK1151

Cell membrane0.145

Rank 3 · TkA03G134210 · TK1151

Mitochondrion0.091

Rank 4 · TkA03G134210 · TK1151

Golgi apparatus0.077

Rank 5 · TkA03G134210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03552Cellulose_synt5-80 aa

PF11744ALMT53-227 aa

PF26387DUF6079_5th83-107 aa

PF27626CNOT10_TPR87-166 aa

PF03552Cellulose_synt125-144 aa

PF26387DUF6079_5th163-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G134210	`PF03552`	Cellulose_synt	5	80	2.5e-10	40.3
TkA03G134210	`PF11744`	ALMT	53	227	9.9e-21	74.9
TkA03G134210	`PF26387`	DUF6079_5th	83	107	0.093	13.2
TkA03G134210	`PF27626`	CNOT10_TPR	87	166	0.014	15.8
TkA03G134210	`PF03552`	Cellulose_synt	125	144	2.5e-10	40.3
TkA03G134210	`PF26387`	DUF6079_5th	163	237	0.093	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRW9`	Arabidopsis thaliana	sp\|Q9SRW9\|CSLD5_ARATH Cellulose synthase-like protein D5	57.900%	Swiss-Prot	Low
`Q9SHM1`	Arabidopsis thaliana	sp\|Q9SHM1\|ALMT6_ARATH Aluminum-activated malate transporter 6	41.500%	Swiss-Prot	Medium
`Q93Z29`	Arabidopsis thaliana	sp\|Q93Z29\|ALMT5_ARATH Aluminum-activated malate transporter 5	40.900%	Swiss-Prot	Medium
`Q9C6L8`	Arabidopsis thaliana	sp\|Q9C6L8\|ALMT4_ARATH Aluminum-activated malate transporter 4	38.200%	Swiss-Prot	Medium
`Q2QNS6`	Oryza sativa subsp. japonica	sp\|Q2QNS6\|CSLD4_ORYSJ Cellulose synthase-like protein D4	55.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card