TkA03G134190 | RubberDandelionOmics

Gene overview

TkA03G134190

Reference: TK1151 Chr: Chr03 Coordinates: 34392207-34393841 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1055 bp · TkA03G134190|TK1151|cDNA

GGAGATGTGACCAGTGCTATTCAGTTGGTCATTTATGGGGACGGTCCGCGACCATCCACGTCAATCACAAGAACCATCGGATTTGTGCACCCGATTCTCCTTACTTCTCATAGGCTGAAGAAATTTTGGGTACCCAGCTTATCTTTCTTCCTCACTCCTGAATTTCCCCTGCTTCAATCGCAATTCTCAACATATAACAAACAAAAATGGCGTCTTCGTTAAGGCCAACTCTTACTGCTTCGCTTCCTGCCTGTAATGCT...

CDS

Download CDS FASTA

657 bp · TkA03G134190|TK1151|CDS

ATGGCGTCTTCGTTAAGGCCAACTCTTACTGCTTCGCTTCCTGCCTGTAATGCTACAACTCAATCCCCCAAACTATACCCTTCCGCCATTAACCCCTTCAAATCCTCCCAATCCCACTTCCATGGCCTTAAACTCTCCCTCGCGATCCCCTCTTCCTTTTCTTCTTTCACTCCTTCGATCAGCAAGACCTCCGTCATTGTATCTGCTAAGGTGACCAAAGGGTCTGTAGCGCCGTCGTTCACACTGAAAGATCAAGACGG...

Protein

Download Protein FASTA

218 aa · TkA03G134190|TK1151|PROTEIN

MASSLRPTLTASLPACNATTQSPKLYPSAINPFKSSQSHFHGLKLSLAIPSSFSSFTPSISKTSVIVSAKVTKGSVAPSFTLKDQDGKTVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAQVVGISGDDAESHKAFAKKYRLPFTLLSDEGNKVRKDWGVPSDLFGTLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKLLQSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G134190`
TK1151 ID	TkA03G134190
OH-1004 ID	LXL04_002283
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G134190`
Location	Chr03:34392207-34393841 (+)
Description	Similar to PRXQ: Peroxiredoxin Q, chloroplastic (Fragment)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002283` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0034599 cellular response to oxidative stress Biological Process GO:0045454 cell redox homeostasis Biological Process GO:0005737 cytoplasm Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009543 chloroplast thylakoid lumen Cellular Component GO:0008379 thioredoxin peroxidase activity Molecular Function
KEGG gene cross-reference	dosa:Os06g0196300 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.986

Rank 1 · TkA03G134190 · TK1151

Mitochondrion0.025

Rank 2 · TkA03G134190 · TK1151

Nucleus0.011

Rank 3 · TkA03G134190 · TK1151

Cytoplasm0.011

Rank 4 · TkA03G134190 · TK1151

Cell membrane0.009

Rank 5 · TkA03G134190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14578GTP_EFTU_D462-90 aa

PF08534Redoxin73-206 aa

PF02630SCO1-SenC73-133 aa

PF00578AhpC-TSA74-196 aa

PF24388Permuted_GreAB-C77-101 aa

PF00255GSHPx80-137 aa

PF13905Thioredoxin_897-173 aa

PF13911AhpC-TSA_2121-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G134190	`PF14578`	GTP_EFTU_D4	62	90	0.21	12.2
TkA03G134190	`PF08534`	Redoxin	73	206	2.6e-28	99.4
TkA03G134190	`PF02630`	SCO1-SenC	73	133	2.8e-06	27.9
TkA03G134190	`PF00578`	AhpC-TSA	74	196	1.8e-43	148.2
TkA03G134190	`PF24388`	Permuted_GreAB-C	77	101	0.046	14.1
TkA03G134190	`PF00255`	GSHPx	80	137	0.028	14.7
TkA03G134190	`PF13905`	Thioredoxin_8	97	173	0.001	20.1
TkA03G134190	`PF13911`	AhpC-TSA_2	121	181	0.0015	19.7
TkA03G134190	`PF02630`	SCO1-SenC	128	213	2.8e-06	27.9
TkA03G134190	`PF24388`	Permuted_GreAB-C	181	197	0.046	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card