TkA03G129980 | RubberDandelionOmics

Gene overview

TkA03G129980

Reference: TK1151 Chr: Chr03 Coordinates: 33357440-33360037 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1958 bp · TkA03G129980|TK1151|cDNA

TATGATTTTAAAGAAAAGTATGTGAGAGAGAAAGTGAATATGTGAGAGAGATTGAGAGAGAAACGTGGCGGGAATACAGCACAACCGGAAATACGAAAACCTGCAGAAGTCGCCACGTTGCCGAATGTAGTCGGTACACAGTCCTTCACCGCTTTCAACGTAACATCCATCATTCCTCCTCCATTCCCAACCATTTCACAGCCTCTCCAAAATCATATATCCAATTTCTTTCTCCCTTTTAAGACTTTCTGTTCCTCCGA...

CDS

Download CDS FASTA

1512 bp · TkA03G129980|TK1151|CDS

ATGGGGAAGGCGGTGGTTCTGATGGTGTTATGGCTTACGGCGACTGCGACTGTATGCCGGAGTTCCAACACGGCGGAGAGGGCCGTCGAGAACGTGAAAGAGAAGGCGAGTGAGGCGGCAGGGAATGTGAAGTTGAAGGCCGAAGGTGCGGTGGATGGGGCTAAGGATAAGAGCGGTACATGGGCAGATTGGGCCATGGTAAAAGTGGCCACGGGCCTCGGTTTGAGCAAGGATGGGGTCAAAGAGGGTGCTCACAGTGC...

Protein

Download Protein FASTA

503 aa · TkA03G129980|TK1151|PROTEIN

MGKAVVLMVLWLTATATVCRSSNTAERAVENVKEKASEAAGNVKLKAEGAVDGAKDKSGTWADWAMVKVATGLGLSKDGVKEGAHSAADKAGDAASKSTSQLKNVASESSKYVSEKAGEVGNLASEKAGKAIDCAGDVKEDGEVKAFEAYAYISELAQEAMKKVQSMAGVTQVIIEEKVGDTEVVIEETGINVYDQGLDMAENAKDTMNDKAYEADKVIRMATDRAVSKGKNKAEDAYNLGADLASDLAKNAKERGSDAY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G129980`
TK1151 ID	TkA03G129980
OH-1004 ID	LXL04_007170
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.300
Protein coverage (%)	TK1151 47.714 / OH-1004 48.780 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G129980`
Location	Chr03:33357440-33360037 (-)
Description	Similar to Late embryogenesis abundant protein D-29
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007170` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009414 response to water deprivation Biological Process
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.446

Rank 1 · TkA03G129980 · TK1151

Cytoplasm0.184

Rank 2 · TkA03G129980 · TK1151

Mitochondrion0.101

Rank 3 · TkA03G129980 · TK1151

Nucleus0.072

Rank 4 · TkA03G129980 · TK1151

Cell membrane0.050

Rank 5 · TkA03G129980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28971COR1523-58 aa

PF28971COR1580-161 aa

PF27005DUF832694-167 aa

PF16058Mucin-like98-104 aa

PF28971COR15137-217 aa

PF28971COR15174-274 aa

PF27005DUF8326238-282 aa

PF28971COR15245-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G129980	`PF28971`	COR15	23	58	2.8	8.6
TkA03G129980	`PF28971`	COR15	80	161	2.8	8.6
TkA03G129980	`PF27005`	DUF8326	94	167	1.4	10.0
TkA03G129980	`PF16058`	Mucin-like	98	104	0.0064	17.5
TkA03G129980	`PF28971`	COR15	137	217	2.8	8.6
TkA03G129980	`PF28971`	COR15	174	274	2.8	8.6
TkA03G129980	`PF27005`	DUF8326	238	282	1.4	10.0
TkA03G129980	`PF28971`	COR15	245	328	2.8	8.6
TkA03G129980	`PF16058`	Mucin-like	293	381	0.0064	17.5
TkA03G129980	`PF16058`	Mucin-like	374	439	0.0064	17.5
TkA03G129980	`PF28971`	COR15	424	498	2.8	8.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card