TkA03G127990 | RubberDandelionOmics

Gene overview

TkA03G127990

Reference: TK1151 Chr: Chr03 Coordinates: 32841602-32842333 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

732 bp · TkA03G127990|TK1151|cDNA

ATGACCACCAGCGACGACGAGGAGATCAACCCTGTCACGATGCTGCTATTAGACAGTGATGATGCTGAAGAGCAAAATGGGAAGAAATCCGAACTTGTTCCTACGCCGGTTCAACACCAAAACTACCACCTCACGTCCATCGATTCCACCGTCGTAATTCGTCAACTTCCCTCCCAGGGCCTCTCCTTCCAGCTCTGGCCGGCCGCCTCCACTTTCGTCAAACTCCTCGACTGCTACAAGGTTTCTAATACCGATTCATT...

CDS

Download CDS FASTA

732 bp · TkA03G127990|TK1151|CDS

ATGACCACCAGCGACGACGAGGAGATCAACCCTGTCACGATGCTGCTATTAGACAGTGATGATGCTGAAGAGCAAAATGGGAAGAAATCCGAACTTGTTCCTACGCCGGTTCAACACCAAAACTACCACCTCACGTCCATCGATTCCACCGTCGTAATTCGTCAACTTCCCTCCCAGGGCCTCTCCTTCCAGCTCTGGCCGGCCGCCTCCACTTTCGTCAAACTCCTCGACTGCTACAAGGTTTCTAATACCGATTCATT...

Protein

Download Protein FASTA

243 aa · TkA03G127990|TK1151|PROTEIN

MTTSDDEEINPVTMLLLDSDDAEEQNGKKSELVPTPVQHQNYHLTSIDSTVVIRQLPSQGLSFQLWPAASTFVKLLDCYKVSNTDSFSAAITRVKRRPRLRILELGSGTGIVGIAASAILGADVTVTDLPHVLANLKFNADANSKVLAPRGGEVQVAALSWGENEEMEAIGRDYDLIIGSDVVYHENKVFLMGHLRRWKKESGFFKKAKKYFQVELVHEDGPSTASRTGVVVYRFARKDAVFR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G127990`
TK1151 ID	TkA03G127990
OH-1004 ID	LXL04_002267
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G127990`
Location	Chr03:32841602-32842333 (+)
Description	Similar to EEF1AKMT3: EEF1A lysine methyltransferase 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002267` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006479 protein methylation Biological Process GO:0018022 peptidyl-lysine methylation Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005694 chromosome Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005813 centrosome Cellular Component GO:0005829 cytosol Cellular Component GO:0032991 protein-containing complex Cellular Component GO:0008168 methyltransferase activity Molecular Function GO:0016279 protein-lysine N-methyltransferase activity Molecular Function GO:0031072 heat shock protein binding Molecular Function
KEGG gene cross-reference	bta:100125307 dre:541441 hsa:25895 mmu:100504608 xtr:549414 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.603

Rank 1 · TkA03G127990 · TK1151

Nucleus0.594

Rank 2 · TkA03G127990 · TK1151

Mitochondrion0.047

Rank 3 · TkA03G127990 · TK1151

Peroxisome0.035

Rank 4 · TkA03G127990 · TK1151

Cell membrane0.034

Rank 5 · TkA03G127990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10294Methyltransf_1651-189 aa

PF01135PCMT88-143 aa

PF13489Methyltransf_2396-185 aa

PF06325PrmA98-132 aa

PF13649Methyltransf_25102-140 aa

PF08242Methyltransf_12103-204 aa

PF10294Methyltransf_16187-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G127990	`PF10294`	Methyltransf_16	51	189	2.4e-24	86.7
TkA03G127990	`PF01135`	PCMT	88	143	0.2	12.1
TkA03G127990	`PF13489`	Methyltransf_23	96	185	0.0055	17.2
TkA03G127990	`PF06325`	PrmA	98	132	0.12	12.5
TkA03G127990	`PF13649`	Methyltransf_25	102	140	0.17	13.3
TkA03G127990	`PF08242`	Methyltransf_12	103	204	0.019	16.4
TkA03G127990	`PF10294`	Methyltransf_16	187	210	2.4e-24	86.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card