TkA03G126260 | RubberDandelionOmics

Gene overview

TkA03G126260

Reference: TK1151 Chr: Chr03 Coordinates: 32392490-32394416 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1635 bp · TkA03G126260|TK1151|cDNA

ATTAGATTGAAATTTTTTTAATGTTACTTCTTTCCTTTTTAACTTATTATTTCTTTTTTCTTTTATCGGGGAGAAGGAGCAGTTCCTAGTTCCTACTCCTAATCGTGAACAGCAGTACAGCACACACAACACCGTAGAAACGTAACTCCAGAAACAATATGAAGTGCCCGTACTGTGCGGCGGCGCAAGGGCGGTGCATCACCACATCTGCTGGTAGGTTTATCACGGAGTGCATATCCTGCGGCCGAGTCGTGGAAGAA...

CDS

Download CDS FASTA

1323 bp · TkA03G126260|TK1151|CDS

ATGAAGTGCCCGTACTGTGCGGCGGCGCAAGGGCGGTGCATCACCACATCTGCTGGTAGGTTTATCACGGAGTGCATATCCTGCGGCCGAGTCGTGGAAGAACGGCAAACGCAATCCCATCACCTCTTCCACATACGTGCTCAAGACTCTCCTCTCTGCCTAGTTACCTCGGACCTCCCCACACTCCCCCACTCTATCATCGACCGATCCACCACCACCACCGCCGTGCCCATCTCCGAAGAAGAAGAAGAAGACCCCTT...

Protein

Download Protein FASTA

440 aa · TkA03G126260|TK1151|PROTEIN

MKCPYCAAAQGRCITTSAGRFITECISCGRVVEERQTQSHHLFHIRAQDSPLCLVTSDLPTLPHSIIDRSTTTTAVPISEEEEEDPFEPTGFITAFSTWSLEPYPVFAQSSLSFAGHLAELERVLETTSSSSASGPSVVVDNLRAYLQIIDVASILGLDCDISDHAFQLFRDCSSATCLRNRSVEALATAALVQAIREAQEPRTLQEISIAANLPQKEIGKYIKILGEALQLSQPLNSNSISVHMPRFCTLLQLNKSAQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G126260`
TK1151 ID	TkA03G126260
OH-1004 ID	LXL04_007137
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G126260

Location Chr03:32392490-32394416 (+)

Description Similar to PBRP1: Plant-specific TFIIB-related protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36650`	Plant-specific TFIIB-related protein that may be involved in an intracellular signaling pathway between plastids and the nucleus.	Transcription factor IIB (TFIIB)-related protein (pBrp), a plant-specific member of the TFIIB-related protein family.2003 · DOI: 10.1128/mcb.23.9.3274-3286.2003 The plant-specific TFIIB-related protein, pBrp, is a general transcription factor for RNA polymerase I.2008 · DOI: 10.1038/emboj.2008.151

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007137 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001174 transcriptional start site selection at RNA polymerase II promoter Biological Process

GO:0006352 DNA-templated transcription initiation Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0006473 protein acetylation Biological Process

GO:0010467 gene expression Biological Process

GO:0019083 viral transcription Biological Process

GO:0051123 RNA polymerase II preinitiation complex assembly Biological Process

GO:0051177 meiotic sister chromatid cohesion Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051276 chromosome organization Biological Process

GO:0070897 transcription preinitiation complex assembly Biological Process

KEGG gene cross-reference

ath:AT4G36650

ddi:DDB_G0290929

mmu:229906

rno:81673

xla:394390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.911

Rank 1 · TkA03G126260 · TK1151

Cytoplasm0.132

Rank 2 · TkA03G126260 · TK1151

Cell membrane0.028

Rank 3 · TkA03G126260 · TK1151

Plastid0.023

Rank 4 · TkA03G126260 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA03G126260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08271Zn_Ribbon_TF1-36 aa

PF02148zf-UBP25-56 aa

PF00382TFIIB145-226 aa

PF02148zf-UBP173-183 aa

PF02984Cyclin_C187-203 aa

PF08280HTH_Mga204-229 aa

PF00382TFIIB243-324 aa

PF02984Cyclin_C259-325 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G126260	`PF08271`	Zn_Ribbon_TF	1	36	0.018	15.3
TkA03G126260	`PF02148`	zf-UBP	25	56	0.36	11.8
TkA03G126260	`PF00382`	TFIIB	145	226	2.2e-27	95.6
TkA03G126260	`PF02148`	zf-UBP	173	183	0.36	11.8
TkA03G126260	`PF02984`	Cyclin_C	187	203	0.0027	18.4
TkA03G126260	`PF08280`	HTH_Mga	204	229	0.046	14.5
TkA03G126260	`PF00382`	TFIIB	243	324	2.2e-27	95.6
TkA03G126260	`PF02984`	Cyclin_C	259	325	0.0027	18.4
TkA03G126260	`PF08280`	HTH_Mga	296	321	0.046	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23215`	Arabidopsis thaliana	sp\|O23215\|PBRP1_ARATH Plant-specific TFIIB-related protein 1	84.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card