Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1571 bp · TkA03G122670|TK1151|cDNA
AAAAAATGAACAAAAAAGATTGGTTTAGTCGGTTTGGAAAATCGATTCACATTTGATGCCCAAACTATAAAAAAATAGAAATAAAACATCTATTGAGAAAAATAGTTTTTTTATAAAATTACATAATCTTCTCCTCTTTATTGACTATTGTTATAATATAAAGTATAAACTATTTAAAAAGCTAAATTTGGCCCAGTTCACTTTTAGGCATTGCCGATGGATACAATGAGCGGGAGGCGTGCGTGATGTCTTGGTTGTAC...
342 bp · TkA03G122670|TK1151|CDS
ATGGAGACGCGATGCCTTCCTATTGCTGTTGTCCGCCTCCTCTCAGTCTCTCATTCTTTTATTCTCTCTAAAAAAAGTTCTCTCATGGCAACAGTGATGCAGACGCTTTCTCAGCAAAAGGCATCTACAGAGAAAAAGAGGTGGACACTTAGTGACTTCGACATTGGCAAGCCGCTAGGAAGGGCAAAATTTGGTCATGTCTATGTAGAAAAGAAAAAGAGAAGCAATCATGTTGTGGCATTTAAATATATTTTCAAAAG...
Protein
Download Protein FASTA113 aa · TkA03G122670|TK1151|PROTEIN
METRCLPIAVVRLLSVSHSFILSKKSSLMATVMQTLSQQKASTEKKRWTLSDFDIGKPLGRAKFGHVYVEKKKRSNHVVAFKYIFKSQLKQSQVKHNFTVKLKSKAILDTLIF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G122670 |
|---|---|
| TK1151 ID | TkA03G122670 |
| OH-1004 ID | LXL04_025901 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 68.200 |
| Protein coverage (%) | TK1151 58.407 / OH-1004 22.603Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G122670 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:31368137-31371504 (+) | |||||||||
| Description | Similar to AUR1: Serine/threonine-protein kinase Aurora-1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000212 meiotic spindle organization Biological Process GO:0000226 microtubule cytoskeleton organization Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0006468 protein phosphorylation Biological Process GO:0007051 spindle organization Biological Process GO:0007052 mitotic spindle organization Biological Process GO:0007057 spindle assembly involved in female meiosis I Biological Process GO:0007098 centrosome cycle Biological Process GO:0007100 mitotic centrosome separation Biological Process GO:0009611 response to wounding Biological Process GO:0009948 anterior/posterior axis specification Biological Process GO:0010629 negative regulation of gene expression Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G25880 ath:AT2G45490 ath:AT4G32830 bta:504437 mmu:20878 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00069Pkinase33-33 aaPF00069Pkinase54-94 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G122670 | PF00069 | Pkinase | 33 | 33 | 0.0091 | 16.1 |
| TkA03G122670 | PF00069 | Pkinase | 54 | 94 | 0.0091 | 16.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.