TkA03G122150 | RubberDandelionOmics

Gene overview

TkA03G122150

Reference: TK1151 Chr: Chr03 Coordinates: 31231337-31233431 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1471 bp · TkA03G122150|TK1151|cDNA

CCGAGATCTATATTCGCTGGATATTTATGAGCCTCTTAAATGCACTGCGACAATTATTTCATACATAATTCAAAGGAAGTCATTCATTTGGGTGTCGCCATTCGCCAGCCATGTATCAAGCTTGCTTCAATAACAAGTTCACGAATTCACTTGTGTACTACGTGTTATTGTCATTTTTACTTCTCATTTCACCTTTTCTTTTCATTTGGGAACTCATCACCACCCTCCCATCATGTTTCCAACCTATCGAAAACATGTCG...

CDS

Download CDS FASTA

843 bp · TkA03G122150|TK1151|CDS

ATGTTTCCAACCTATCGAAAACATGTCGGGGAAAGTGGTTTGATCACCGGTGCTTCATCAGGACTCGGAGAGCTCATGGCTTACGAATATGCAAAAAGAGGTGCATGCCTAGCAATTGTAGCAATAAAAGAACTCGATAGTCGACTTATGCAAGTAGCAGATAAAGCTCTGGAACTCGGCTCTCCCGATGTTCTTTTCATGTTTGCTGATGTGTCAAAGGTCGAAGAGTGTAGGAGATTCGTGGATGACACTATTAAACG...

Protein

Download Protein FASTA

280 aa · TkA03G122150|TK1151|PROTEIN

MFPTYRKHVGESGLITGASSGLGELMAYEYAKRGACLAIVAIKELDSRLMQVADKALELGSPDVLFMFADVSKVEECRRFVDDTIKRFDRLDHLVCNAGIGNLYSVNIDVTKFAPVMDINFWGSIYPTHFAIPHLMRTGGKIVVNASSAGVLHPPKGGFYNASKAALIGFYESLRFEVSPRITITILTLGFIETRIITAKYLTSGVGGHLKKDFSSLLPTMGAEPCAKAIVNGVCKGATSIVEPRFMKGLFLIKFLFPQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G122150`
TK1151 ID	TkA03G122150
OH-1004 ID	LXL04_025742
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.100
Protein coverage (%)	TK1151 95.000 / OH-1004 83.912 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G122150

Location Chr03:31231337-31233431 (+)

Description Similar to HSD7: 11-beta-hydroxysteroid dehydrogenase-like 4B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50600`	Catalyzes 11-beta, 17-beta-hydroxysteroid and reduces 17- beta-ketosteroids.	At5g50600 encodes a member of the short-chain dehydrogenase reductase superfamily with 11beta- and 17beta-hydroxysteroid dehydrogenase activities associated with Arabidopsis thaliana seed oil bodies.2007 · DOI: 10.1016/j.biochi.2006.09.013 A putative hydroxysteroid dehydrogenase involved in regulating plant growth and development.2007 · DOI: 10.1104/pp.107.100560 Regulation of HSD1 in seeds of Arabidopsis thaliana.2009 · DOI: 10.1093/pcp/pcp092
`At5g50700`	Catalyzes 11-beta, 17-beta-hydroxysteroid and reduces 17- beta-ketosteroids.	Regulation of HSD1 in seeds of Arabidopsis thaliana.2009 · DOI: 10.1093/pcp/pcp092
`At5g50590`	11-beta-hydroxysteroid dehydrogenase-like 4A.	No verified direct reference in this release
`At5g50690`	11-beta-hydroxysteroid dehydrogenase-like 4B.	No verified direct reference in this release
`At3g47350`	11-beta-hydroxysteroid dehydrogenase-like 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025742 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006694 steroid biosynthetic process Biological Process

GO:0008202 steroid metabolic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005811 lipid droplet Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004303 estradiol 17-beta-dehydrogenase [NAD(P)+] activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0070524 11-beta-hydroxysteroid dehydrogenase (NADP+) activity Molecular Function

KEGG gene cross-reference

ath:AT5G50590

ath:AT5G50600

ath:AT5G50690

ath:AT5G50700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.407

Rank 1 · TkA03G122150 · TK1151

Mitochondrion0.171

Rank 2 · TkA03G122150 · TK1151

Cytoplasm0.157

Rank 3 · TkA03G122150 · TK1151

Peroxisome0.083

Rank 4 · TkA03G122150 · TK1151

Cell membrane0.078

Rank 5 · TkA03G122150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106adh_short14-197 aa

PF08659KR14-184 aa

PF13561adh_short_C217-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G122150	`PF00106`	adh_short	14	197	2.5e-37	129.0
TkA03G122150	`PF08659`	KR	14	184	4.3e-05	24.2
TkA03G122150	`PF13561`	adh_short_C2	17	197	2.4e-25	90.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DKC5`	Arabidopsis thaliana	sp\|P0DKC5\|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A	46.500%	Swiss-Prot	Medium
`P0DKC6`	Arabidopsis thaliana	sp\|P0DKC6\|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B	46.500%	Swiss-Prot	Medium
`P0DKC7`	Arabidopsis thaliana	sp\|P0DKC7\|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A	45.800%	Swiss-Prot	Medium
`Q9LUF2`	Arabidopsis thaliana	sp\|Q9LUF2\|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B	45.800%	Swiss-Prot	Medium
`Q9STY8`	Arabidopsis thaliana	sp\|Q9STY8\|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2	30.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card