TkA03G119590 | RubberDandelionOmics

Gene overview

TkA03G119590

Reference: TK1151 Chr: Chr03 Coordinates: 30536724-30541915 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3517 bp · TkA03G119590|TK1151|cDNA

TTTTTTGAGAGAGTATTATTAGACATATTTTCTCAGATGTTTTTCACCTTTATCTGCATGAGCTGGTATCACACCCTCCTTATATTCTTCTCCAAAGCAAGAAGAAAAAGGCGAACCTGAGATTCTGTTCATAAAGAAAAGCAAGATTTGAAAAATCAGGAAAAACAGACAGAATGTGAATCAACGCTGCACACAAACTCATCAATCAATCAAAAAAAGCTGAGTTCAAGTGGAGTCCAGACTCCGAGAGATGTCGATCC...

CDS

Download CDS FASTA

795 bp · TkA03G119590|TK1151|CDS

ATGATCATCAGAGCACCTTCCAGCTCGATTGATGTCTGTGTATGCTGTGCGACAACCGGTTCTCCATTTCTATCCACACTTGAGCTCCGCCCGTTGAATCTATCGATGTACGCTACTGATTTTGAGGATAATTTCTTCTTAAAAGTGGCAGCTAGGGTTAACTTCGGAGCTTCAAGCACGGACGCCGTAAGGTTTCCAGATGATCCGTACGACCGGATTTGGGATTCGGATCTAGCAAAACGGCAGAATTTTCTGGTGGG...

Protein

Download Protein FASTA

264 aa · TkA03G119590|TK1151|PROTEIN

MIIRAPSSSIDVCVCCATTGSPFLSTLELRPLNLSMYATDFEDNFFLKVAARVNFGASSTDAVRFPDDPYDRIWDSDLAKRQNFLVGVAPGTVRINTTKEINTNTREYPPVKVMQTAVVGTQGSLSYRLNLEDFPANARAYAYFAEIQDLPDNETRKFTMKEPYVPDYSNAVVNIEENANGSYTLYEPSYMNVSLSFVFSFSFKKTMDSSQGPLLNAVEISKYVPIASKTDRKDVNVLGAFRSMLEIGDMIEEGDPCVPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G119590`
TK1151 ID	TkA03G119590
OH-1004 ID	LXL04_025785
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.242 / OH-1004 27.406 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G119590

Location Chr03:30536724-30541915 (-)

Description Similar to At1g67720: Probable LRR receptor-like serine/threonine-protein kinase At1g67720

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67720`	Probable LRR receptor-like serine/threonine-protein kinase At1g67720.	No verified direct reference in this release
`At1g51860`	Probable LRR receptor-like serine/threonine-protein kinase At1g51860.	No verified direct reference in this release
`At1g51880`	Probable LRR receptor-like serine/threonine-protein kinase At1g51880.	No verified direct reference in this release
`At3g46340`	Putative receptor-like protein kinase At3g46340.	No verified direct reference in this release
`At1g51890`	Probable LRR receptor-like protein kinase At1g51890.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025785 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G67720

ath:AT2G14510

ath:AT2G19230

ath:AT3G21340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.770

Rank 1 · TkA03G119590 · TK1151

Cell membrane0.095

Rank 2 · TkA03G119590 · TK1151

Endoplasmic reticulum0.069

Rank 3 · TkA03G119590 · TK1151

Cytoplasm0.057

Rank 4 · TkA03G119590 · TK1151

Lysosome / Vacuole0.026

Rank 5 · TkA03G119590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12819Malectin_like2-222 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G119590	`PF12819`	Malectin_like	2	222	5e-49	168.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGI2`	Arabidopsis thaliana	sp\|C0LGI2\|Y1677_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g67720	76.500%	Swiss-Prot	High
`C0LGG4`	Arabidopsis thaliana	sp\|C0LGG4\|Y1518_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51860	31.200%	Swiss-Prot	Medium
`Q9FZB1`	Arabidopsis thaliana	sp\|Q9FZB1\|Y5188_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51880	28.900%	Swiss-Prot	Low
`Q9SNA3`	Arabidopsis thaliana	sp\|Q9SNA3\|Y3463_ARATH Putative receptor-like protein kinase At3g46340	29.300%	Swiss-Prot	Low
`C0LGG6`	Arabidopsis thaliana	sp\|C0LGG6\|Y5189_ARATH Probable LRR receptor-like protein kinase At1g51890	28.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card