TkA03G117280 | RubberDandelionOmics

Gene overview

TkA03G117280

Reference: TK1151 Chr: Chr03 Coordinates: 29987159-29988604 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

885 bp · TkA03G117280|TK1151|cDNA

AGCAATGGTTACATATCAGCAAACGATGCTTACGTTGGGTTAGCACCACCGGGCGCTGCAGGATCATGGCAAAAAGAAAACAAGAAATACCAATTTTGGACCAAAGCGGATAAGGAAGGCTATTTTTCCATAAAGAACATAGTCACCGGTGAATACAATCTATACGCTTGGGTTCCGGGATTTATTGGCGATTATAAAAATTCTGAGATCATCAATATTACTTCAGGTGTTAATATCAACATGGGTGAGCTTGTATATCA...

CDS

Download CDS FASTA

885 bp · TkA03G117280|TK1151|CDS

AGCAATGGTTACATATCAGCAAACGATGCTTACGTTGGGTTAGCACCACCGGGCGCTGCAGGATCATGGCAAAAAGAAAACAAGAAATACCAATTTTGGACCAAAGCGGATAAGGAAGGCTATTTTTCCATAAAGAACATAGTCACCGGTGAATACAATCTATACGCTTGGGTTCCGGGATTTATTGGCGATTATAAAAATTCTGAGATCATCAATATTACTTCAGGTGTTAATATCAACATGGGTGAGCTTGTATATCA...

Protein

Download Protein FASTA

294 aa · TkA03G117280|TK1151|PROTEIN

SNGYISANDAYVGLAPPGAAGSWQKENKKYQFWTKADKEGYFSIKNIVTGEYNLYAWVPGFIGDYKNSEIINITSGVNINMGELVYQPPRYGPTLWAIGFPDRTAAEFYIPDPKTKYANKFLLQGPNRFRQYGLWSRYSDLYPHQDLVYTIGESNYRKDFFFAHVLREKGKGIYQSTTWTIKFHLDHVNLSGTYILRLALASAHQSDLLVHINDLKSDPLFSTGYIGGDNAIARHGIHGLYWLFSVKIPGSLLYTRGLNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G117280`
TK1151 ID	TkA03G117280
OH-1004 ID	LXL04_031100
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	63.700
Protein coverage (%)	TK1151 99.660 / OH-1004 33.221 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G117280`
Location	Chr03:29987159-29988604 (-)
Description	Similar to rhiE: Rhamnogalacturonate lyase (Dickeya dadantii (strain 3937)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031100` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000272 polysaccharide catabolic process Biological Process GO:0005975 carbohydrate metabolic process Biological Process GO:0045490 pectin catabolic process Biological Process GO:0071555 cell wall organization Biological Process GO:0005576 extracellular region Cellular Component GO:0004112 cyclic-nucleotide phosphodiesterase activity Molecular Function GO:0016837 carbon-oxygen lyase activity, acting on polysaccharides Molecular Function GO:0030246 carbohydrate binding Molecular Function GO:0102210 rhamnogalacturonan endolyase activity Molecular Function
KEGG gene cross-reference	ang:An11g00390 ani:ANIA_04139 ani:ANIA_06395 ddd:Dda3937_01465 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.351

Rank 1 · TkA03G117280 · TK1151

Lysosome / Vacuole0.225

Rank 2 · TkA03G117280 · TK1151

Cytoplasm0.173

Rank 3 · TkA03G117280 · TK1151

Endoplasmic reticulum0.138

Rank 4 · TkA03G117280 · TK1151

Cell membrane0.088

Rank 5 · TkA03G117280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14686fn3_38-79 aa

PF22904NOMO1-like_2nd26-62 aa

PF09430EMC7_beta-sandw27-62 aa

PF13620CarboxypepD_reg30-62 aa

PF13715CarbopepD_reg_232-63 aa

PF13620CarboxypepD_reg90-115 aa

PF14683CBM-like94-282 aa

PF22904NOMO1-like_2nd180-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G117280	`PF14686`	fn3_3	8	79	1.7e-24	86.1
TkA03G117280	`PF22904`	NOMO1-like_2nd	26	62	0.041	14.8
TkA03G117280	`PF09430`	EMC7_beta-sandw	27	62	0.11	13.4
TkA03G117280	`PF13620`	CarboxypepD_reg	30	62	0.0057	17.7
TkA03G117280	`PF13715`	CarbopepD_reg_2	32	63	0.09	13.5
TkA03G117280	`PF13620`	CarboxypepD_reg	90	115	0.0057	17.7
TkA03G117280	`PF14683`	CBM-like	94	282	1.4e-47	162.3
TkA03G117280	`PF22904`	NOMO1-like_2nd	180	196	0.041	14.8
TkA03G117280	`PF09430`	EMC7_beta-sandw	182	213	0.11	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card