Gene Card
Gene overview
cDNA / CDS / Protein Sequences
477 bp · TkA03G116080|TK1151|cDNA
ATGGCTACTCGAATAAGTTTCCAAAGATATATTGAATGCATATGTTTTCTTCTTTGTTTCGTCCAAAACATTGTTTTATCTCTATTTTGCTTCATCGGTTTGTATCATCCAGTCAAATTCCACCATCATGATCATCAAACACGACCAAGAAGACCTCCAATTTCAGCAGTTTTGATTCGAGAGTTCCTTGTAACCGTTAAATTTGGCGACATGATGGTAGCCGAATCTTCAACAACTTGTGCAATATGTCTCGATGAGTT...
477 bp · TkA03G116080|TK1151|CDS
ATGGCTACTCGAATAAGTTTCCAAAGATATATTGAATGCATATGTTTTCTTCTTTGTTTCGTCCAAAACATTGTTTTATCTCTATTTTGCTTCATCGGTTTGTATCATCCAGTCAAATTCCACCATCATGATCATCAAACACGACCAAGAAGACCTCCAATTTCAGCAGTTTTGATTCGAGAGTTCCTTGTAACCGTTAAATTTGGCGACATGATGGTAGCCGAATCTTCAACAACTTGTGCAATATGTCTCGATGAGTT...
Protein
Download Protein FASTA158 aa · TkA03G116080|TK1151|PROTEIN
MATRISFQRYIECICFLLCFVQNIVLSLFCFIGLYHPVKFHHHDHQTRPRRPPISAVLIREFLVTVKFGDMMVAESSTTCAICLDEFEGEDDVMFLTNCKHMFHQKCLDDWMDQIQDACPVCRTCFLPLAFQEEYRKQLKISVGLDNFYGEDFVIVGL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G116080 |
|---|---|
| TK1151 ID | TkA03G116080 |
| OH-1004 ID | LXL04_022621 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 57.000 |
| Protein coverage (%) | TK1151 95.570 / OH-1004 49.835Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G116080 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:29705143-29705619 (-) | |||||||||
| Description | Similar to BRH1: Brassinosteroid-responsive RING protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009741 response to brassinosteroid Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process GO:0010200 response to chitin Biological Process GO:0016567 protein ubiquitination Biological Process GO:0047484 regulation of response to osmotic stress Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:1901371 regulation of leaf morphogenesis Biological Process GO:1905421 regulation of plant organ morphogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G23980 ath:AT2G01150 ath:AT2G35420 ath:AT3G18930 ath:AT3G61460 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13920zf-C3HC4_311-19 aaPF13639zf-RING_213-30 aaPF31263RING_Ste554-65 aaPF23413zf_RING_Vps8_fungal75-85 aaPF11789zf-Nse75-122 aaPF14569zf-UDP76-126 aaPF13920zf-C3HC4_377-124 aaPF14446Prok-RING_177-108 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G116080 | PF13920 | zf-C3HC4_3 | 11 | 19 | 9.9e-05 | 22.8 |
| TkA03G116080 | PF13639 | zf-RING_2 | 13 | 30 | 4e-14 | 53.3 |
| TkA03G116080 | PF31263 | RING_Ste5 | 54 | 65 | 1.0 | 10.0 |
| TkA03G116080 | PF23413 | zf_RING_Vps8_fungal | 75 | 85 | 0.0022 | 17.9 |
| TkA03G116080 | PF11789 | zf-Nse | 75 | 122 | 0.025 | 15.1 |
| TkA03G116080 | PF14569 | zf-UDP | 76 | 126 | 0.11 | 13.3 |
| TkA03G116080 | PF13920 | zf-C3HC4_3 | 77 | 124 | 9.9e-05 | 22.8 |
| TkA03G116080 | PF14446 | Prok-RING_1 | 77 | 108 | 0.0001 | 23.1 |
| TkA03G116080 | PF17120 | zf-RING_16 | 77 | 122 | 0.00012 | 22.3 |
| TkA03G116080 | PF12861 | zf-ANAPC11 | 78 | 126 | 1.7e-07 | 31.9 |
| TkA03G116080 | PF04641 | Rtf2 | 78 | 126 | 0.028 | 14.5 |
| TkA03G116080 | PF13639 | zf-RING_2 | 79 | 123 | 4e-14 | 53.3 |
| TkA03G116080 | PF23555 | zf-RING_Vps41 | 79 | 115 | 0.0042 | 17.4 |
| TkA03G116080 | PF25998 | U-box_ZFPL1 | 79 | 119 | 0.32 | 12.1 |
| TkA03G116080 | PF27108 | PHD_Pygo | 79 | 108 | 0.43 | 11.4 |
| TkA03G116080 | PF21202 | SLX1_C | 79 | 125 | 6.4 | 7.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.