TkA03G108120 | RubberDandelionOmics

Gene overview

TkA03G108120

Reference: TK1151 Chr: Chr03 Coordinates: 27678980-27691104 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1753 bp · TkA03G108120|TK1151|cDNA

AAAGATTTGATAAGTTTTAAGACATTATGACATGCATACAAAGTATGTAAGAAACTAAAAAATCGTGTTAAATATTTGATTGTTATTAAACAATGTAAATATTGGTTACAACTGTTCAGACGCAAATCGCCATTAATAGTTGCAGCGGCACCTTCTTGTCTTCTCTCAAACACACTCGGATTACACATACCGCCATGACAACCACCGATCTCGCCACCATCTTACCTCGTGTGCTCATAGTATCTAGACGAAGCCTTCGC...

CDS

Download CDS FASTA

2055 bp · TkA03G108120|TK1151|CDS

ATGAATTCTTCCAAACATCTGATTTTAAATTTTCTTACTTTCTTCATTCTTGGAGAGTGTTCAACAAACCCTGACGAATTCTACACCACCTGCAATGATTCCTTCAATTGCGGGAATATTTCCGGCTTCCGATTCCCCTTCCGGAAAGAAACCGATCCCGAACACTGCGGGTACCCTGGTTTTGAACTTAAATGTAATCAAGATATCCCACCTACCATCACCATCAAGAACATGACTTACCGTGTCCAAAGCATCGATCC...

Protein

Download Protein FASTA

684 aa · TkA03G108120|TK1151|PROTEIN

MNSSKHLILNFLTFFILGECSTNPDEFYTTCNDSFNCGNISGFRFPFRKETDPEHCGYPGFELKCNQDIPPTITIKNMTYRVQSIDPTAKIIKIIREDMIESICPQNLVNTTVDYNLFDYTSGNMNMSILFGCPGSWNNLGVESILCSNKGGSPAFFIPGVHGPGDCETSVVVPVPVTVLDPNTVGRVVGSGFEVRWKVDDGICTGCRQSGGRCVYDNVTSLAACGCPKPHTLAGSCGEVNETRAVASPSSGSSRKGSVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G108120`
TK1151 ID	TkA03G108120
OH-1004 ID	LXL04_007062
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	76.700
Protein coverage (%)	TK1151 97.222 / OH-1004 66.850 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G108120

Location Chr03:27678980-27691104 (+)

Description Similar to GAT1_2.1: Putative glutamine amidotransferase GAT1_2.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g66880`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.4.	No verified direct reference in this release
`At5g38210`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.3.	No verified direct reference in this release
`At1g18390`	Probable receptor-like serine/threonine-protein kinase involved in abscisic acid (ABA) signaling.	The AtLRK10L1.2, Arabidopsis ortholog of wheat LRK10, is involved in ABA-mediated signaling and drought resistance.2015 · DOI: 10.1007/s00299-014-1724-2
`At1g25390`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1.	No verified direct reference in this release
`At1g15040`	Putative glutamine amidotransferase that represses shoot branching.	A nitrogen-regulated glutamine amidotransferase (GAT1_2.1) represses shoot branching in Arabidopsis.2012 · DOI: 10.1104/pp.112.199364

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007062 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0042631 cellular response to water deprivation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016740 transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G15040

ath:AT1G18390

ath:AT1G66880

ath:AT5G38210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.860

Rank 1 · TkA03G108120 · TK1151

Cytoplasm0.088

Rank 2 · TkA03G108120 · TK1151

Endoplasmic reticulum0.080

Rank 3 · TkA03G108120 · TK1151

Nucleus0.055

Rank 4 · TkA03G108120 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA03G108120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13947GUB_WAK_bind31-95 aa

PF14380WAK_assoc165-228 aa

PF14654Epiglycanin_C214-238 aa

PF18303Saf_2TM254-317 aa

PF28128TMEM98_N259-291 aa

PF14654Epiglycanin_C260-283 aa

PF00069Pkinase352-623 aa

PF07714PK_Tyr_Ser-Thr354-625 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G108120	`PF13947`	GUB_WAK_bind	31	95	5.7e-16	59.4
TkA03G108120	`PF14380`	WAK_assoc	165	228	7.8e-11	43.3
TkA03G108120	`PF14654`	Epiglycanin_C	214	238	8.3	7.4
TkA03G108120	`PF18303`	Saf_2TM	254	317	0.064	13.6
TkA03G108120	`PF28128`	TMEM98_N	259	291	0.19	12.2
TkA03G108120	`PF14654`	Epiglycanin_C	260	283	8.3	7.4
TkA03G108120	`PF00069`	Pkinase	352	623	5.6e-48	164.3
TkA03G108120	`PF07714`	PK_Tyr_Ser-Thr	354	625	5.8e-48	164.2
TkA03G108120	`PF03109`	ABC1	362	404	1.6e-05	24.9
TkA03G108120	`PF03109`	ABC1	416	504	1.6e-05	24.9
TkA03G108120	`PF14654`	Epiglycanin_C	443	455	8.3	7.4
TkA03G108120	`PF17667`	Pkinase_fungal	464	503	0.11	11.9
TkA03G108120	`PF14531`	Kinase-like	466	515	0.013	15.5
TkA03G108120	`PF12330`	Haspin_kinase	472	502	0.0088	15.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HQ17`	Arabidopsis thaliana	sp\|F4HQ17\|LRL14_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.4	46.000%	Swiss-Prot	Medium
`Q8VYG0`	Arabidopsis thaliana	sp\|Q8VYG0\|LRL13_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.3	43.500%	Swiss-Prot	Medium
`P0C5E2`	Arabidopsis thaliana	sp\|P0C5E2\|LRL12_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.2	43.000%	Swiss-Prot	Medium
`Q9C6K9`	Arabidopsis thaliana	sp\|Q9C6K9\|LRL11_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1	42.800%	Swiss-Prot	Medium
`Q8H0Z4`	Arabidopsis thaliana	sp\|Q8H0Z4\|GT121_ARATH Putative glutamine amidotransferase GAT1_2.1	62.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card