TkA03G103370 | RubberDandelionOmics

Gene overview

TkA03G103370

Reference: TK1151 Chr: Chr03 Coordinates: 26423170-26425486 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1263 bp · TkA03G103370|TK1151|cDNA

TTTAATCACTCCTCGGATTTACACGATGAAAACTTCGTTAGCGTGTTATCATGATATATCTAACAAAACACGAACAATAATAAAACGCAGCAAGCAAAGGTAGTCACAGGACCAACACACCACCGCGCAGAAGAAGATGGAGAAGGGTTGTGTAACAGCGGCGTTAACAACAACACCGGCAGCACTATTACCACAAAGCTTCTTCGCCCAAACCCTAACACCCATTTATCATTATTACACACCCAATCTAATACTAGAAG...

CDS

Download CDS FASTA

729 bp · TkA03G103370|TK1151|CDS

ATGCCCAAATTCGAAGAACTCGATACCACCAACATGCTTCTCCGTCAACGTATCGTCTTCTTGGGATCCCAGGTGGATGATATGTCAGCTGATTTTATAATCAGCCAGTTGCTATTCCTCGATGCAGAAGATGATAAAAAGGATATAAAGTTGTTCATCAATTCACCTGGTGGTTCTGTTACTGCAGGAATGGGTATATATGATGCAATGAAGCTATGTAAGGCGGATATTTCCACCATTTGTGTTGGATTAGCTGCATC...

Protein

Download Protein FASTA

242 aa · TkA03G103370|TK1151|PROTEIN

MPKFEELDTTNMLLRQRIVFLGSQVDDMSADFIISQLLFLDAEDDKKDIKLFINSPGGSVTAGMGIYDAMKLCKADISTICVGLAASMGAFLLACGTKGKRFCMPNSRVMIHQPLGQAGGNATDMSIRLREMVYHKVKVNKIISRVSGTPYEKVEADTDRDYFMNAWEAKAYGIVDEVIDDGKPGLVAPIADVKPPPKTRVWDLWKVEGSRKAMKNMPSEDKMLKNGYIGGNEEKEEEGAST

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G103370`
TK1151 ID	TkA03G103370
OH-1004 ID	LXL04_007015
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 75.155 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G103370

Location Chr03:26423170-26425486 (+)

Description Similar to CLPP3: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g66670`	Cleaves peptides in various proteins in a process that requires ATP hydrolysis.	Modified Clp protease complex in the ClpP3 null mutant and consequences for chloroplast development and function in Arabidopsis.2013 · DOI: 10.1104/pp.113.215699

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007015 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009368 endopeptidase Clp complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009532 plastid stroma Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009840 chloroplastic endopeptidase Clp complex Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004176 ATP-dependent peptidase activity Molecular Function

GO:0004252 serine-type endopeptidase activity Molecular Function

GO:0051117 ATPase binding Molecular Function

KEGG gene cross-reference

ath:AT1G66670

ava:Ava_0547

syc:syc1584_c

syf:Synpcc7942_2525

tel:tlr0509

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.380

Rank 1 · TkA03G103370 · TK1151

Nucleus0.332

Rank 2 · TkA03G103370 · TK1151

Mitochondrion0.137

Rank 3 · TkA03G103370 · TK1151

Cell membrane0.096

Rank 4 · TkA03G103370 · TK1151

Endoplasmic reticulum0.078

Rank 5 · TkA03G103370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00574CLP_protease7-180 aa

PF25145NfeD1b_N40-124 aa

PF01972SDH_protease44-92 aa

PF21006NHase_beta_N153-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G103370	`PF00574`	CLP_protease	7	180	2.3e-75	253.2
TkA03G103370	`PF25145`	NfeD1b_N	40	124	0.0023	18.3
TkA03G103370	`PF01972`	SDH_protease	44	92	0.058	13.1
TkA03G103370	`PF21006`	NHase_beta_N	153	223	0.016	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXJ6`	Arabidopsis thaliana	sp\|Q9SXJ6\|CLPP3_ARATH ATP-dependent Clp protease proteolytic subunit 3, chloroplastic	75.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card