TkA03G102660 | RubberDandelionOmics

Gene overview

TkA03G102660

Reference: TK1151 Chr: Chr03 Coordinates: 26238088-26240801 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2044 bp · TkA03G102660|TK1151|cDNA

GGTCGTCATAAATTATAGTAGGTGACGAAATCGCCTGCTGCTTGCTGCCGTGTCTCTCTATCTCTTTTATCAGATATCATGTTTACGAGCTGAGCAATTACAACTTACCAAGTCACATGAAAATCATATGAGTAAACTTCAAGAAGAGATAAGGGAACTCAAAAGAAAGCACGAGCAACTACTGTCCCAAGTCCCAACAGGATATAGAATGGAAAAAGCTGCACGTTTGGAATTAGAAACAAAACCTGGCCATCAGTCTA...

CDS

Download CDS FASTA

1737 bp · TkA03G102660|TK1151|CDS

ATGAGTAAACTTCAAGAAGAGATAAGGGAACTCAAAAGAAAGCACGAGCAACTACTGTCCCAAGTCCCAACAGGATATAGAATGGAAAAAGCTGCACGTTTGGAATTAGAAACAAAACCTGGCCATCAGTCTACTATAAAGAATGTGACACCAAATGCTTTTGAATATATTCCAGAGGAGTTGATACAACTCATCCAATCACACTTGCCAGTAAACGAACGGGCCCGCACGACCGTGTTGTCCAAGTCATGGCAACACGC...

Protein

Download Protein FASTA

578 aa · TkA03G102660|TK1151|PROTEIN

MSKLQEEIRELKRKHEQLLSQVPTGYRMEKAARLELETKPGHQSTIKNVTPNAFEYIPEELIQLIQSHLPVNERARTTVLSKSWQHAWSTNPDLSFPVVRGEKSTELVDRTLKRYLRENISFEKLDLEIDINKWKFSLAEKLIGLIATKTCLKEFSLSVMSSFYSYNNEFTLSDGLLLCENLTKIRVQGTRRREDNCVIMTTSLHPVIKCVSLRELDLFRVSIREEALNHILSSCTLLVKIRLEQLNTCNGLKTIKAKNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G102660`
TK1151 ID	TkA03G102660
OH-1004 ID	LXL04_006979
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.200
Protein coverage (%)	TK1151 76.817 / OH-1004 98.886 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G102660`
Location	Chr03:26238088-26240801 (-)
Description	No functional description available
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006979` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.862

Rank 1 · TkA03G102660 · TK1151

Cytoplasm0.166

Rank 2 · TkA03G102660 · TK1151

Cell membrane0.052

Rank 3 · TkA03G102660 · TK1151

Endoplasmic reticulum0.040

Rank 4 · TkA03G102660 · TK1151

Plastid0.016

Rank 5 · TkA03G102660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like55-87 aa

PF00646F-box57-91 aa

PF08770SoxZ76-107 aa

PF27087LRR_TMOD-LMOD101-193 aa

PF29594LRR_SKP2137-165 aa

PF23622LRR_At1g61320_AtMIF1148-345 aa

PF24758LRR_At5g56370165-248 aa

PF29594LRR_SKP2204-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G102660	`PF12937`	F-box-like	55	87	0.052	14.0
TkA03G102660	`PF00646`	F-box	57	91	0.00095	19.7
TkA03G102660	`PF08770`	SoxZ	76	107	0.35	11.3
TkA03G102660	`PF27087`	LRR_TMOD-LMOD	101	193	0.25	11.7
TkA03G102660	`PF29594`	LRR_SKP2	137	165	0.0013	18.8
TkA03G102660	`PF23622`	LRR_At1g61320_AtMIF1	148	345	2.8e-06	27.7
TkA03G102660	`PF24758`	LRR_At5g56370	165	248	3e-11	44.1
TkA03G102660	`PF29594`	LRR_SKP2	204	323	0.0013	18.8
TkA03G102660	`PF00646`	F-box	226	234	0.00095	19.7
TkA03G102660	`PF24758`	LRR_At5g56370	277	368	3e-11	44.1
TkA03G102660	`PF23622`	LRR_At1g61320_AtMIF1	308	389	2.8e-06	27.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card