TkA03G089020 | RubberDandelionOmics

Gene overview

TkA03G089020

Reference: TK1151 Chr: Chr03 Coordinates: 22648254-22649826 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1040 bp · TkA03G089020|TK1151|cDNA

AAAATAGTCGCTAATCCACAATCCGTAAAGAGCTTCGGGTGTTTGTTCAGTACAGTGAGACTGAAAGATCGTTGCAGACGACGATGTCGAAGTGGTGGCGAACAGCGGTGGTTCTCCAGAGAAAAGCGGCGGCGGCGTCAAAGTCATACCACACGATTCAAGCCATTCCTAGAGAGATTTGCGGCAATAGAGTCTCAGTAAAAGATAGAGCCCAAGGCCGTATACCCGCAGTCGTTTTCGCACAACCTAACCCTAGCACT...

CDS

Download CDS FASTA

726 bp · TkA03G089020|TK1151|CDS

ATGTCGAAGTGGTGGCGAACAGCGGTGGTTCTCCAGAGAAAAGCGGCGGCGGCGTCAAAGTCATACCACACGATTCAAGCCATTCCTAGAGAGATTTGCGGCAATAGAGTCTCAGTAAAAGATAGAGCCCAAGGCCGTATACCCGCAGTCGTTTTCGCACAACCTAACCCTAGCACTGACGGCGGTGGTAGTCCTCCGTGGTCTGTTTCCAGAAAGCACCTAGTAACAACCGAAAAAAGGCAGATTCAGTCTATTCTCAA...

Protein

Download Protein FASTA

241 aa · TkA03G089020|TK1151|PROTEIN

MSKWWRTAVVLQRKAAAASKSYHTIQAIPREICGNRVSVKDRAQGRIPAVVFAQPNPSTDGGGSPPWSVSRKHLVTTEKRQIQSILNSIELPYFCSTTFPLQIRAGSGSSTLLESGNVLPIKVHRDPETGKLLNLVFVWADEGTELKVDVPIVFKGEDVCPGLKKGGFLNKIRTSLKYKCPSEHIPQKIEVDISNLDIGDKVFMKDINVHSSLELLSKNESLPVCKIAAAKIDSTMPTQTA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G089020`
TK1151 ID	TkA03G089020
OH-1004 ID	LXL04_038848
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	39.900
Protein coverage (%)	TK1151 88.382 / OH-1004 77.778 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G089020`
Location	Chr03:22648254-22649826 (-)
Description	Similar to rplY: 50S ribosomal protein L25 (Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038848` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006412 translation Biological Process GO:0022625 cytosolic large ribosomal subunit Cellular Component GO:0003735 structural constituent of ribosome Molecular Function GO:0008097 5S rRNA binding Molecular Function
KEGG gene cross-reference	bid:Bind_3582 eli:ELI_05840 nar:Saro_2115 pla:Plav_2257 sal:Sala_1617 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.870

Rank 1 · TkA03G089020 · TK1151

Plastid0.097

Rank 2 · TkA03G089020 · TK1151

Nucleus0.052

Rank 3 · TkA03G089020 · TK1151

Cytoplasm0.049

Rank 4 · TkA03G089020 · TK1151

Cell membrane0.013

Rank 5 · TkA03G089020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01386Ribosomal_L25p25-135 aa

PF14693Ribosomal_TL5_C146-230 aa

PF01386Ribosomal_L25p190-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G089020	`PF01386`	Ribosomal_L25p	25	135	9.1e-06	26.7
TkA03G089020	`PF14693`	Ribosomal_TL5_C	146	230	1.4e-24	87.0
TkA03G089020	`PF01386`	Ribosomal_L25p	190	210	9.1e-06	26.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card