TkA03G085210 | RubberDandelionOmics

Gene overview

TkA03G085210

Reference: TK1151 Chr: Chr03 Coordinates: 21704785-21710081 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

657 bp · TkA03G085210|TK1151|cDNA

ATGGAAGGTTTTTGTTCGTGGACTGCGGCGAGCACGGGGGTGTGTTCAATTTCGGCTGAAACGGGCTGGAAAGGGCGAAATCGACGAAACGTGGCGGCGACGATCTGGGTTTATCGCGAAATCAGGAGCAGCGGCGATCTAGGGCTTCTGCGTCGCGACGAGGAAGATGACTGGAAGCAGTGGCTCGCGATGGCGTCAGACGACGGGAGGCGAAGCAGGAGCGGAGGATTGCCGGTGGAGAAGATGGATGCGACGGGAAC...

CDS

Download CDS FASTA

657 bp · TkA03G085210|TK1151|CDS

ATGGAAGGTTTTTGTTCGTGGACTGCGGCGAGCACGGGGGTGTGTTCAATTTCGGCTGAAACGGGCTGGAAAGGGCGAAATCGACGAAACGTGGCGGCGACGATCTGGGTTTATCGCGAAATCAGGAGCAGCGGCGATCTAGGGCTTCTGCGTCGCGACGAGGAAGATGACTGGAAGCAGTGGCTCGCGATGGCGTCAGACGACGGGAGGCGAAGCAGGAGCGGAGGATTGCCGGTGGAGAAGATGGATGCGACGGGAAC...

Protein

Download Protein FASTA

218 aa · TkA03G085210|TK1151|PROTEIN

MEGFCSWTAASTGVCSISAETGWKGRNRRNVAATIWVYREIRSSGDLGLLRRDEEDDWKQWLAMASDDGRRSRSGGLPVEKMDATGTDRDGEGGRVRPRRRREITTYSHLKYFGLDKPGLKLGVVGLGGLGNVAVKMAKAFGAEVTVFSTTTGKKEESLERLKADHFIVSKQNRCRYSVAGTLDGIIDTVSTTHPIAPLLSALKPQGKLVLVGAPESH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G085210`
TK1151 ID	TkA03G085210
OH-1004 ID	LXL04_014029
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.600
Protein coverage (%)	TK1151 51.835 / OH-1004 31.389 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G085210`
Location	Chr03:21704785-21710081 (+)
Description	Similar to GEDH1: Geraniol dehydrogenase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014029` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009809 lignin biosynthetic process Biological Process GO:0009820 alkaloid metabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0045551 cinnamyl-alcohol dehydrogenase activity Molecular Function GO:0046029 mannitol dehydrogenase activity Molecular Function GO:0047924 geraniol dehydrogenase activity Molecular Function GO:0102311 8-hydroxygeraniol dehydrogenase activity Molecular Function
KEGG gene cross-reference	ag:AAC15467 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.479

Rank 1 · TkA03G085210 · TK1151

Nucleus0.297

Rank 2 · TkA03G085210 · TK1151

Endoplasmic reticulum0.108

Rank 3 · TkA03G085210 · TK1151

Cell membrane0.098

Rank 4 · TkA03G085210 · TK1151

Plastid0.088

Rank 5 · TkA03G085210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF028262-Hacid_dh_C108-158 aa

PF03446NAD_binding_2121-168 aa

PF027373HCDH_N121-190 aa

PF01262AlaDh_PNT_C122-200 aa

PF00107ADH_zinc_N129-216 aa

PF13602ADH_zinc_N_2162-214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G085210	`PF02826`	2-Hacid_dh_C	108	158	1e-05	25.7
TkA03G085210	`PF03446`	NAD_binding_2	121	168	0.079	13.7
TkA03G085210	`PF02737`	3HCDH_N	121	190	0.22	12.1
TkA03G085210	`PF01262`	AlaDh_PNT_C	122	200	9.9e-05	22.6
TkA03G085210	`PF00107`	ADH_zinc_N	129	216	1.4e-12	48.3
TkA03G085210	`PF13602`	ADH_zinc_N_2	162	214	0.074	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card