TkA03G073650 | RubberDandelionOmics

Gene overview

TkA03G073650

Reference: TK1151 Chr: Chr03 Coordinates: 18876820-18880096 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1629 bp · TkA03G073650|TK1151|cDNA

ATTATGGGCTATTTTAACAGTGTTATGGTCTAAGCCTTTTTACCAGCCCAACAAGTCGCATCGATATCTAAACCCTGATCACGAGAACAGGCCTGAGGCGACAGGCGAGAGTGGAGCACAAACCCCATCTTCCTCCCCAGTCATCGATTCTTCAATTGGACACCTTCTAATTCATTAACTCCGATTTTTTCATCAGAAGGAACAATCTGAAAAATAATGGTCAAAACAAAGATTAAGAAATCGAAACCAAATAAGCACCC...

CDS

Download CDS FASTA

1104 bp · TkA03G073650|TK1151|CDS

ATGGTCAAAACAAAGATTAAGAAATCGAAACCAAATAAGCACCCCAGTACTAAAAAGAACAGCAAGCAATCGGACATTTCAGAATTTCGAGCTCAGCTTGATGCATTAGGTTTAAAAATCATACAAGTAACTGCAGACGGGAATTGCTTCTTCAGAGCTGTAGCAGATCAATTGGAAGGAGATGAAGATAAGCATGAAAAATATCGGAAAATGGTTGTGCACTATATCATGAAAAACCGTGAAAATTTTGAGCCTTTTAT...

Protein

Download Protein FASTA

367 aa · TkA03G073650|TK1151|PROTEIN

MVKTKIKKSKPNKHPSTKKNSKQSDISEFRAQLDALGLKIIQVTADGNCFFRAVADQLEGDEDKHEKYRKMVVHYIMKNRENFEPFIEDEVPFDEYCESMEKDGTWAGNMELQAASLVTHSNICIHRISSPRWYIKNFDDRDAQMIHLSYHDLEHYNSVRLKDDTCDGPTRPIIIKADAELSVKSHQPNGASKTVVQADSIKTVKLGSGCENEHKIQQVLLQVNGDVDAAIEFIIADEETEQNLVESNGVDFSMEASHEC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G073650`
TK1151 ID	TkA03G073650
OH-1004 ID	LXL04_006801
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G073650

Location Chr03:18876820-18880096 (+)

Description Similar to OTU7: OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67170`	Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation.	No verified direct reference in this release
`At2g27350`	Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation.	Involvement of KDM1C histone demethylase-OTLD1 otubain-like histone deubiquitinase complexes in plant gene repression.2011 · DOI: 10.1073/pnas.1014030108 Distinct phylogenetic relationships and biochemical properties of Arabidopsis ovarian tumor-related deubiquitinases support their functional differentiation.2014 · DOI: 10.3389/fpls.2014.00084 The histone deubiquitinase OTLD1 targets euchromatin to regulate plant growth.2016 · DOI: 10.1126/scisignal.aaf6767 Activation of gene expression by histone deubiquitinase OTLD1.2017 · DOI: 10.1080/15592294.2017.1348446

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006801 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006307 DNA alkylation repair Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006508 proteolysis Biological Process

GO:0009966 regulation of signal transduction Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0031669 cellular response to nutrient levels Biological Process

GO:0032790 ribosome disassembly Biological Process

GO:0034122 negative regulation of toll-like receptor signaling pathway Biological Process

GO:0035871 protein K11-linked deubiquitination Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0044313 protein K6-linked deubiquitination Biological Process

GO:0044314 protein K27-linked ubiquitination Biological Process

KEGG gene cross-reference

ath:AT2G27350

ath:AT5G67170

hsa:23252

mmu:73162

mmu:73945

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.524

Rank 1 · TkA03G073650 · TK1151

Cytoplasm0.448

Rank 2 · TkA03G073650 · TK1151

Cell membrane0.105

Rank 3 · TkA03G073650 · TK1151

Endoplasmic reticulum0.060

Rank 4 · TkA03G073650 · TK1151

Golgi apparatus0.048

Rank 5 · TkA03G073650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10275Peptidase_C6540-55 aa

PF29258OTU_Vertnin41-82 aa

PF02338OTU45-156 aa

PF29446DUF855555-75 aa

PF10275Peptidase_C6568-128 aa

PF29258OTU_Vertnin93-124 aa

PF29258OTU_Vertnin250-287 aa

PF02338OTU269-287 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G073650	`PF10275`	Peptidase_C65	40	55	1.7e-06	28.4
TkA03G073650	`PF29258`	OTU_Vertnin	41	82	1.5e-05	25.8
TkA03G073650	`PF02338`	OTU	45	156	3.7e-18	67.0
TkA03G073650	`PF29446`	DUF8555	55	75	0.2	12.4
TkA03G073650	`PF10275`	Peptidase_C65	68	128	1.7e-06	28.4
TkA03G073650	`PF29258`	OTU_Vertnin	93	124	1.5e-05	25.8
TkA03G073650	`PF29258`	OTU_Vertnin	250	287	1.5e-05	25.8
TkA03G073650	`PF02338`	OTU	269	287	3.7e-18	67.0
TkA03G073650	`PF02810`	SEC-C	302	319	1.4e-06	28.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K3M6`	Arabidopsis thaliana	sp\|F4K3M6\|OTU7_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 7	57.100%	Swiss-Prot	High
`Q9XIP2`	Arabidopsis thaliana	sp\|Q9XIP2\|OTU6_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 6	28.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card