TkA03G066200 | RubberDandelionOmics

Gene overview

TkA03G066200

Reference: TK1151 Chr: Chr03 Coordinates: 17047942-17052988 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2499 bp · TkA03G066200|TK1151|cDNA

AATCAAACAAGTATAAAAAATTTGATTATATTTTTATTTTTTTAACTTTGATTTGTTTGAAGTTTAAATGAAATAAAGGAAGCAAGTTAAAGAAAGGGATTAGATTATTAGATGCAAACAACAAGAAGAAGAAGGTCGTCGTCTTCGTTCGTCGTCGTTCGTGTCGGGAACGTTACTTACCGCTGACTTCACCATCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCGCCCTCGCTATTCTCTCTCTAAAACTCCCTAGAG...

CDS

Download CDS FASTA

1974 bp · TkA03G066200|TK1151|CDS

ATGTCGCGATTCACGGCCCTCTTGATCTGGTCGGTTTTTGTACTGTTTCACTATCCTCCGTCGTTCTCATTAAGGTATGTTTCTGCTCTTATAAACGATTCGACCGCTGTTATTATCCGGCCTCCACACGCCGGTAGCAATCGCCACACCATGTTTCTACCTCTTTTCCCCTCTCCTCCTAACTCCTCCCGGATCTCCGGCGATGCGAAATCTCGCCGGCACCTCCAGAAATCAGATGCTCGTCGACCTAACGCTCGCAT...

Protein

Download Protein FASTA

657 aa · TkA03G066200|TK1151|PROTEIN

MSRFTALLIWSVFVLFHYPPSFSLRYVSALINDSTAVIIRPPHAGSNRHTMFLPLFPSPPNSSRISGDAKSRRHLQKSDARRPNARMALHDDLLLNGYYTTRLWIGSPPQKFALIVDTGSTVTYVPCATCEQCGKHQDPKFDPDASSTYKPVKCNIDCTCDSNKEQCIYERQYAEMSSSSGVLGEDIISFGNQSDLQPQRAVFGCENRETGDLYSQHADGIMGLGRGDLSIIDQLVDGGVISDSFSLCYGGMDVGGGAMV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G066200`
TK1151 ID	TkA03G066200
OH-1004 ID	LXL04_013590
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	68.300
Protein coverage (%)	TK1151 99.848 / OH-1004 98.620 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G066200

Location Chr03:17047942-17052988 (-)

Description Similar to At1g65240: Aspartic proteinase-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g36260`	Displays aspartic proteolytic activity.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2ZC67`	Possesses protease activity in vitro.	No verified direct reference in this release
`Os04g0448500`	Anther-specific aspartic protease involved in tapetal programmed cell death (PCD).	EAT1 promotes tapetal cell death by regulating aspartic proteases during male reproductive development in rice.2013 · DOI: 10.1038/ncomms2396

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013590 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009555 pollen development Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G49050

ath:AT1G65240

ath:AT5G36260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.551

Rank 1 · TkA03G066200 · TK1151

Lysosome / Vacuole0.135

Rank 2 · TkA03G066200 · TK1151

Cytoplasm0.116

Rank 3 · TkA03G066200 · TK1151

Extracellular0.107

Rank 4 · TkA03G066200 · TK1151

Endoplasmic reticulum0.096

Rank 5 · TkA03G066200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543TAXi_N99-263 aa

PF00026Asp99-436 aa

PF13975gag-asp_proteas110-139 aa

PF14541TAXi_C283-436 aa

PF23041DUF7036288-304 aa

PF13975gag-asp_proteas311-331 aa

PF10256Erf4493-543 aa

PF23180ALE2_N498-591 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G066200	`PF14543`	TAXi_N	99	263	1.9e-37	129.8
TkA03G066200	`PF00026`	Asp	99	436	5e-34	118.9
TkA03G066200	`PF13975`	gag-asp_proteas	110	139	0.21	12.9
TkA03G066200	`PF14541`	TAXi_C	283	436	3.2e-28	99.3
TkA03G066200	`PF23041`	DUF7036	288	304	0.00031	22.0
TkA03G066200	`PF13975`	gag-asp_proteas	311	331	0.21	12.9
TkA03G066200	`PF10256`	Erf4	493	543	0.23	12.2
TkA03G066200	`PF23180`	ALE2_N	498	591	0.00012	22.9
TkA03G066200	`PF23041`	DUF7036	510	572	0.00031	22.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4V3D2`	Arabidopsis thaliana	sp\|Q4V3D2\|ASP36_ARATH Aspartic proteinase 36	34.400%	Swiss-Prot	Medium
`A2ZC67`	Oryza sativa subsp. indica	sp\|A2ZC67\|ASP1_ORYSI Aspartic proteinase Asp1	26.700%	Swiss-Prot	Low
`Q7XV21`	Oryza sativa subsp. japonica	sp\|Q7XV21\|AP37_ORYSJ Aspartyl protease 37	24.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card