TkA03G061020 | RubberDandelionOmics

Gene overview

TkA03G061020

Reference: TK1151 Chr: Chr03 Coordinates: 15752487-15754813 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1472 bp · TkA03G061020|TK1151|cDNA

CACGTAACCCTTATACCTACACACCGCTACATTCACTCCATATATCTATAACAGGTGGTTGTGGAGAGTTTTTATTTCCTCCTCCTCCTCCGCCGCCGCCATGGAAGAAGTTAGGGCTAGCTCCGCCTGGGTCGCATCACATTCTTCTCACGTTACCGTCGATTCCGTAGGCATTGAAAAAGTGGTGGAAAGTGTCGAAAACTCCATTCCGAAAGTTGAATGGAATTACGAAGGGATTCATTACTTCGATAATGGTCCTT...

CDS

Download CDS FASTA

921 bp · TkA03G061020|TK1151|CDS

ATGGAAGAAGTTAGGGCTAGCTCCGCCTGGGTCGCATCACATTCTTCTCACGTTACCGTCGATTCCGTAGGCATTGAAAAAGTGGTGGAAAGTGTCGAAAACTCCATTCCGAAAGTTGAATGGAATTACGAAGGGATTCATTACTTCGATAATGGTCCTTTAACTGTACAATACTTGTTTGTGTTAGACGCTCTCAATTTCTGCTTTTGGCCAGATGACAAGTTAAACTATGATGATTTGGCTTCCGGATTAAAATCAGC...

Protein

Download Protein FASTA

306 aa · TkA03G061020|TK1151|PROTEIN

MEEVRASSAWVASHSSHVTVDSVGIEKVVESVENSIPKVEWNYEGIHYFDNGPLTVQYLFVLDALNFCFWPDDKLNYDDLASGLKSALENDQSVFNADRLQKYTGPELRALLKWPRPLPLEDERVRLMHEVGYELEKSFGGKASNIINSCGKSATNLVAIIARHFPGFRDHTVYKGHQVFLYKRAQIFAADVWGAFKGKGYGEFSDVGSITIFADYIVPAVLQQLGVLKYSSNLVKVIEANKEIGSGTEEEVELRACSIY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G061020`
TK1151 ID	TkA03G061020
OH-1004 ID	LXL04_006717
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G061020`
Location	Chr03:15752487-15754813 (+)
Description	Similar to DDB_G0288723: Queuosine salvage protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006717` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006400 tRNA modification Biological Process GO:0043096 purine nucleobase salvage Biological Process GO:0043174 nucleoside salvage Biological Process GO:0005829 cytosol Cellular Component GO:0016787 hydrolase activity Molecular Function GO:0106432 queuosine nucleosidase activity Molecular Function
KEGG gene cross-reference	bta:767897 ddi:DDB_G0288723 hsa:84267 mmu:70153 sti:Sthe_2331 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.623

Rank 1 · TkA03G061020 · TK1151

Nucleus0.442

Rank 2 · TkA03G061020 · TK1151

Mitochondrion0.096

Rank 3 · TkA03G061020 · TK1151

Peroxisome0.041

Rank 4 · TkA03G061020 · TK1151

Cell membrane0.038

Rank 5 · TkA03G061020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10343Q_salvage47-306 aa

PF03642MAP65-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G061020	`PF10343`	Q_salvage	47	306	5.9e-90	302.4
TkA03G061020	`PF03642`	MAP	65	97	0.19	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card