TkA03G058910 | RubberDandelionOmics

Gene overview

TkA03G058910

Reference: TK1151 Chr: Chr03 Coordinates: 15164671-15165395 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · TkA03G058910|TK1151|cDNA

ATGACTTTACTCGAAGAAGAGAGCTTGAAACTTACCGAAGTTCAAAGGCTCGAAGGTCATACTGATAGGGTATGGGGTCTAGCTTGGAATCCGGCTACCGGTGCTGACGGTGTACCTGCTATCCTCGCTTCTTGTAGCGGCGACAAGACTGTTCGAATCTGGCAACAACGTAGCCCTTCCTCTACATCCTTTGATTGCAAGGCAGTATTAGAAGACAGACATAATCGAACAGTTCTATCATGTTCCTGGTCACCTTCCGG...

CDS

Download CDS FASTA

495 bp · TkA03G058910|TK1151|CDS

ATGACTTTACTCGAAGAAGAGAGCTTGAAACTTACCGAAGTTCAAAGGCTCGAAGGTCATACTGATAGGGTATGGGGTCTAGCTTGGAATCCGGCTACCGGTGCTGACGGTGTACCTGCTATCCTCGCTTCTTGTAGCGGCGACAAGACTGTTCGAATCTGGCAACAACGTAGCCCTTCCTCTACATCCTTTGATTGCAAGGCAGTATTAGAAGACAGACATAATCGAACAGTTCTATCATGTTCCTGGTCACCTTCCGG...

Protein

Download Protein FASTA

164 aa · TkA03G058910|TK1151|PROTEIN

MTLLEEESLKLTEVQRLEGHTDRVWGLAWNPATGADGVPAILASCSGDKTVRIWQQRSPSSTSFDCKAVLEDRHNRTVLSCSWSPSGKQLATASFDATTTIWEQNGTDFECVSTLEGHENEVKSCFMECIWEVLPGNEFYTLSLNEKTDLPSCLGHVRELTDRM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G058910`
TK1151 ID	TkA03G058910
OH-1004 ID	LXL04_006697
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G058910

Location Chr03:15164671-15165395 (+)

Description Similar to CIA1: Protein CIA1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26060`	Essential component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006697 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0051604 protein maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0097361 cytosolic [4Fe-4S] assembly targeting complex Cellular Component

KEGG gene cross-reference

ath:AT2G26060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.543

Rank 1 · TkA03G058910 · TK1151

Nucleus0.458

Rank 2 · TkA03G058910 · TK1151

Cell membrane0.082

Rank 3 · TkA03G058910 · TK1151

Mitochondrion0.071

Rank 4 · TkA03G058910 · TK1151

Endoplasmic reticulum0.069

Rank 5 · TkA03G058910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23775Beta-prop_RIG_2nd6-64 aa

PF24797Beta-prop_WDR35_TULP_N8-96 aa

PF23609Beta-prop_EIPR19-54 aa

PF25174Beta-prop_THOC310-62 aa

PF25172Beta-prop_WDR3_2nd11-56 aa

PF23381Beta-prop_IFT122_1st12-105 aa

PF25175Beta-prop_WDR512-125 aa

PF24807WD40_CDC20-Fz12-60 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G058910	`PF23775`	Beta-prop_RIG_2nd	6	64	0.00022	21.4
TkA03G058910	`PF24797`	Beta-prop_WDR35_TULP_N	8	96	0.0021	18.0
TkA03G058910	`PF23609`	Beta-prop_EIPR1	9	54	0.00041	20.6
TkA03G058910	`PF25174`	Beta-prop_THOC3	10	62	1.3e-19	71.0
TkA03G058910	`PF25172`	Beta-prop_WDR3_2nd	11	56	1.5e-09	38.2
TkA03G058910	`PF23381`	Beta-prop_IFT122_1st	12	105	1e-21	78.3
TkA03G058910	`PF25175`	Beta-prop_WDR5	12	125	3.1e-17	63.5
TkA03G058910	`PF24807`	WD40_CDC20-Fz	12	60	5.4e-13	49.6
TkA03G058910	`PF25173`	Beta-prop_WDR3_1st	12	56	1.7e-12	48.1
TkA03G058910	`PF24105`	Beta-prop_CAF1B_HIR1	12	32	5e-11	42.9
TkA03G058910	`PF24817`	WD40_WDHD1_1st	12	61	3.2e-09	37.1
TkA03G058910	`PF00400`	WD40	13	54	5.9e-19	68.4
TkA03G058910	`PF24814`	WD40_Prp19	14	60	2.6e-12	47.1
TkA03G058910	`PF23869`	Beta-prop_WDR75_1st	14	55	0.00015	21.9
TkA03G058910	`PF25168`	Beta-prop_WDR36-Utp21_2nd	14	113	0.00097	19.2
TkA03G058910	`PF20426`	NBCH_WD40	14	56	0.012	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80990`	Arabidopsis thaliana	sp\|O80990\|CIA1_ARATH Protein CIA1	66.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card