TkA03G048910 | RubberDandelionOmics

Gene overview

TkA03G048910

Reference: TK1151 Chr: Chr03 Coordinates: 12872598-12874690 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · TkA03G048910|TK1151|cDNA

CGAACACGCGTTTTATTGGGCGACGCTCCTATTCGTTTTATATACCGGAAACCGATAGCATTTCTCATCATTTCTAGAAAAACCCTCGAAATTCGCCAGCCGATCAATTTTCTCACTCCAATGGGGCGGAGCAGCAGCAACGGTAGATGGGCTACGGCGGTCGCTTTAGCATTCTGCGCCACATTGCTCGTCATGTTGCCGGAAGTTTCCGCCAAGCGGTTCATCGTCGGAGGCAGCATGGGCTGGACTTCCAACGTTAA...

CDS

Download CDS FASTA

648 bp · TkA03G048910|TK1151|CDS

CGAACACGCGTTTTATTGGGCGACGCTCCTATTCGTTTTATATACCGGAAACCGATAGCATTTCTCATCATTTCTAGAAAAACCCTCGAAATTCGCCAGCCGATCAATTTTCTCACTCCAATGGGGCGGAGCAGCAGCAACGGTAGATGGGCTACGGCGGTCGCTTTAGCATTCTGCGCCACATTGCTCGTCATGTTGCCGGAAGTTTCCGCCAAGCGGTTCATCGTCGGAGGCAGCATGGGCTGGACTTCCAACGTTAA...

Protein

Download Protein FASTA

215 aa · TkA03G048910|TK1151|PROTEIN

RTRVLLGDAPIRFIYRKPIAFLIISRKTLEIRQPINFLTPMGRSSSNGRWATAVALAFCATLLVMLPEVSAKRFIVGGSMGWTSNVNYTLWAGNQTFYFGDWLYFVYDRNQNDILEVNKTNYETCNAEHPVHNYTTGAGRDVVALNVTHDRYFMSSKGSCYGGMKLHVHLSPLPSPPKAAPLKSGGLSRFTAVRSQVIIPAAFAIAAIWDSLIFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G048910`
TK1151 ID	TkA03G048910
OH-1004 ID	LXL04_006573
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 97.674 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G048910

Location Chr03:12872598-12874690 (+)

Description Similar to At5g15350: Lamin-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15350`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At4g12880`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At3g01070`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At3g20570`	May act as a carbohydrate transporter.	An early nodulin-like protein accumulates in the sieve element plasma membrane of Arabidopsis.2007 · DOI: 10.1104/pp.106.092296
`At1g17800`	May act as a carbohydrate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006573 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0009055 electron transfer activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G27035

ath:AT2G32300

ath:AT3G01070

ath:AT4G12880

ath:AT5G15350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.622

Rank 1 · TkA03G048910 · TK1151

Extracellular0.148

Rank 2 · TkA03G048910 · TK1151

Endoplasmic reticulum0.116

Rank 3 · TkA03G048910 · TK1151

Cytoplasm0.091

Rank 4 · TkA03G048910 · TK1151

Golgi apparatus0.072

Rank 5 · TkA03G048910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02298Cu_bind_like82-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G048910	`PF02298`	Cu_bind_like	82	164	6.2e-22	78.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39131`	Arabidopsis thaliana	sp\|Q39131\|ENL17_ARATH Early nodulin-like protein 17	52.500%	Swiss-Prot	High
`Q9STZ8`	Arabidopsis thaliana	sp\|Q9STZ8\|ENL19_ARATH Early nodulin-like protein 19	51.300%	Swiss-Prot	Medium
`Q9MAC1`	Arabidopsis thaliana	sp\|Q9MAC1\|ENL16_ARATH Early nodulin-like protein 16	52.900%	Swiss-Prot	Medium
`Q9LJU1`	Arabidopsis thaliana	sp\|Q9LJU1\|ENL09_ARATH Early nodulin-like protein 9	35.500%	Swiss-Prot	Low
`Q9LMU7`	Arabidopsis thaliana	sp\|Q9LMU7\|ENL22_ARATH Early nodulin-like protein 22	33.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card