TkA03G047320 | RubberDandelionOmics

Gene overview

TkA03G047320

Reference: TK1151 Chr: Chr03 Coordinates: 12477348-12478499 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1152 bp · TkA03G047320|TK1151|cDNA

ATGGCCATTGAAAAGCTTCAAAAAAGAGTGAAAAAAACTCCAAAAGACGTTGCAATCATCTTTGGCGTAACCGGTTTGGTTGGAAAACAACTTCTTGAGAAGCTACTTTCAAAATCCAAATGGAAGGTTTATGGCGTAGCCAGGCGACAAGAGATCATGACGACAATCAAGAAGCAAAACACAAACATAAACCCTAATTACCATTTCATTTCATGCAACCTTCTTGACCCTTTCGAAACACAAACAAAGCTTTCTCATTT...

CDS

Download CDS FASTA

1152 bp · TkA03G047320|TK1151|CDS

ATGGCCATTGAAAAGCTTCAAAAAAGAGTGAAAAAAACTCCAAAAGACGTTGCAATCATCTTTGGCGTAACCGGTTTGGTTGGAAAACAACTTCTTGAGAAGCTACTTTCAAAATCCAAATGGAAGGTTTATGGCGTAGCCAGGCGACAAGAGATCATGACGACAATCAAGAAGCAAAACACAAACATAAACCCTAATTACCATTTCATTTCATGCAACCTTCTTGACCCTTTCGAAACACAAACAAAGCTTTCTCATTT...

Protein

Download Protein FASTA

383 aa · TkA03G047320|TK1151|PROTEIN

MAIEKLQKRVKKTPKDVAIIFGVTGLVGKQLLEKLLSKSKWKVYGVARRQEIMTTIKKQNTNINPNYHFISCNLLDPFETQTKLSHLHDVTHVFWVTWATQFPLDSIECYDQNKAMMSNALDAILPRANLKHFSLQTGTKHYVSLQGTSLIKSVSYYDENSPRVVGCNFYYGLEDLLTERLAGAVPWSVHRPGLIIGSSRSTIYNFMGSLCVYGTICKYLKLPFVFGGRKDCFEEQFVDVSDARLVAKQQIWAATDDLVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G047320`
TK1151 ID	TkA03G047320
OH-1004 ID	LXL04_006545
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G047320

Location Chr03:12477348-12478499 (-)

Description Similar to CYC2: (S)-8-oxocitronellyl enol synthase CYC2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24220`	Involved in vascular strand development.	Involvement of the VEP1 gene in vascular strand development in Arabidopsis thaliana.2002 · DOI: 10.1093/pcp/pcf042 The VEP1 gene (At4g24220) encodes a short-chain dehydrogenase/reductase with 3-oxo-Delta4,5-steroid 5beta-reductase activity in Arabidopsis thaliana L.2009 · DOI: 10.1016/j.biochi.2008.12.005

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006545 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006720 isoprenoid metabolic process Biological Process

GO:0008202 steroid metabolic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0016099 monoterpenoid biosynthetic process Biological Process

GO:0043693 monoterpene biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Molecular Function

GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor Molecular Function

GO:0035671 enone reductase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ag:AFW98981

ath:AT4G24220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.757

Rank 1 · TkA03G047320 · TK1151

Nucleus0.272

Rank 2 · TkA03G047320 · TK1151

Peroxisome0.081

Rank 3 · TkA03G047320 · TK1151

Endoplasmic reticulum0.059

Rank 4 · TkA03G047320 · TK1151

Mitochondrion0.054

Rank 5 · TkA03G047320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01370Epimerase19-133 aa

PF16363GDP_Man_Dehyd20-84 aa

PF07993NAD_binding_422-52 aa

PF13460NAD_binding_1022-138 aa

PF09205DUF195533-124 aa

PF22917PRISE80-330 aa

PF07993NAD_binding_4177-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G047320	`PF01370`	Epimerase	19	133	1.9e-06	28.2
TkA03G047320	`PF16363`	GDP_Man_Dehyd	20	84	0.0001	22.6
TkA03G047320	`PF07993`	NAD_binding_4	22	52	4e-05	23.6
TkA03G047320	`PF13460`	NAD_binding_10	22	138	0.028	15.0
TkA03G047320	`PF09205`	DUF1955	33	124	0.13	12.8
TkA03G047320	`PF22917`	PRISE	80	330	7.1e-10	39.2
TkA03G047320	`PF07993`	NAD_binding_4	177	207	4e-05	23.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STX2`	Arabidopsis thaliana	sp\|Q9STX2\|VEP1_ARATH 3-oxo-Delta(4,5)-steroid 5-beta-reductase	38.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card