TkA03G043260 | RubberDandelionOmics

Gene overview

TkA03G043260

Reference: TK1151 Chr: Chr03 Coordinates: 11370436-11371653 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

534 bp · TkA03G043260|TK1151|cDNA

ATGACACCTGCTCATTTCTTTGATGATTTCCCATCAAGGGATGTGTTTGAAGCAGCCTGCGACCATGCAAGAGATTACAGCAGTTTGCTGTGGGATGACTCCAAAAAAATGCGACTTGTTGTCAAAACCGAAATCTATGTTATGTTTGTCTCTGAGAAACTTGTAATTGGTGTGGGATATGACTGCAATCCCATGGTCTTTGCTAGGGTGCGTGGGACTGATGAATTAAATGCATACTTGAACAAGTATCAGCTAGAACT...

CDS

Download CDS FASTA

534 bp · TkA03G043260|TK1151|CDS

ATGACACCTGCTCATTTCTTTGATGATTTCCCATCAAGGGATGTGTTTGAAGCAGCCTGCGACCATGCAAGAGATTACAGCAGTTTGCTGTGGGATGACTCCAAAAAAATGCGACTTGTTGTCAAAACCGAAATCTATGTTATGTTTGTCTCTGAGAAACTTGTAATTGGTGTGGGATATGACTGCAATCCCATGGTCTTTGCTAGGGTGCGTGGGACTGATGAATTAAATGCATACTTGAACAAGTATCAGCTAGAACT...

Protein

Download Protein FASTA

177 aa · TkA03G043260|TK1151|PROTEIN

MTPAHFFDDFPSRDVFEAACDHARDYSSLLWDDSKKMRLVVKTEIYVMFVSEKLVIGVGYDCNPMVFARVRGTDELNAYLNKYQLELEPQLEALVGKHSRKPWSKFMNAYNQHLVSPEAIDFLDRLTAKEAMLRSIAAKQYHLIKRYKFCETIQCLKDGVEKMKIQCLESGYVGNYH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G043260`
TK1151 ID	TkA03G043260
OH-1004 ID	LXL04_004629
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.200
Protein coverage (%)	TK1151 93.220 / OH-1004 31.810 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G043260

Location Chr03:11370436-11371653 (-)

Description Similar to ARPC1B: Actin-related protein 2/3 complex subunit 1B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67380`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Cloning and characterization of two cDNAs encoding casein kinase II catalytic subunits in Arabidopsis thaliana.1993 · DOI: 10.1007/bf00019944 Reconstitution of Arabidopsis casein kinase II from recombinant subunits and phosphorylation of transcription factor GBF1.1995 · DOI: 10.1105/tpc.7.1.105
`At3g50000`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9AR27`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`UniProt: B6F107`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004629 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007015 actin filament organization Biological Process

GO:0034314 Arp2/3 complex-mediated actin nucleation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005885 Arp2/3 protein complex Cellular Component

GO:0035861 site of double-strand break Cellular Component

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT2G30910

ath:AT2G31300

xla:379845

xla:380108

xla:444264

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.577

Rank 1 · TkA03G043260 · TK1151

Cytoplasm0.444

Rank 2 · TkA03G043260 · TK1151

Mitochondrion0.063

Rank 3 · TkA03G043260 · TK1151

Cell membrane0.037

Rank 4 · TkA03G043260 · TK1151

Endoplasmic reticulum0.032

Rank 5 · TkA03G043260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18307Tfb2_C1-45 aa

PF00941FAD_binding_571-145 aa

PF27660SCI1_hairpin91-113 aa

PF27660SCI1_hairpin122-131 aa

PF18307Tfb2_C125-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G043260	`PF18307`	Tfb2_C	1	45	5.2e-10	40.2
TkA03G043260	`PF00941`	FAD_binding_5	71	145	0.24	11.9
TkA03G043260	`PF27660`	SCI1_hairpin	91	113	0.023	15.1
TkA03G043260	`PF27660`	SCI1_hairpin	122	131	0.023	15.1
TkA03G043260	`PF18307`	Tfb2_C	125	156	5.2e-10	40.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q08467`	Arabidopsis thaliana	sp\|Q08467\|CSK21_ARATH Casein kinase II subunit alpha-1	74.100%	Swiss-Prot	Low
`Q08466`	Arabidopsis thaliana	sp\|Q08466\|CSK22_ARATH Casein kinase II subunit alpha-2	75.700%	Swiss-Prot	Low
`Q9AR27`	Oryza sativa subsp. indica	sp\|Q9AR27\|HD6_ORYSI Casein kinase II subunit alpha-2	71.600%	Swiss-Prot	Low
`B6F107`	Oryza sativa subsp. japonica	sp\|B6F107\|HD6_ORYSJ Casein kinase II subunit alpha-2	71.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card