TkA03G038530 | RubberDandelionOmics

Gene overview

TkA03G038530

Reference: TK1151 Chr: Chr03 Coordinates: 10153912-10157009 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2146 bp · TkA03G038530|TK1151|cDNA

AAAAAACAGAGCACAGTCCACCGACGCGGGATCCGGAATTCGGACCCTATCACGTTCTTCCCCAAATTTACAACTCTCACCCTTTTCAGATCAGATCCCACACATCCCATCATGCTCCTTTCACACAGCTCCAACTACCACTAGTCCACTAGTCCTCTCCAACCTCATTCACTCCAAATCCTCACACTTTGCATTGAAATCACAAGAAGTTTACACGGTACAGTGTTGTTTGTTAGCTAGATCTCGTGCCAAATGGCGGT...

CDS

Download CDS FASTA

1659 bp · TkA03G038530|TK1151|CDS

ATGGCGGTCGTAGCTCGCAGCGGCAGAGGCGCTGGCGGATCGGCGTTTTCCTCCGCTTTACGCAGCTTTTTTTCATACCGGATCTTTGTCTCGGCTATGTTTACGCTTCTTTTCTTCGCAACTGCCTCCGTGCTGTTCTCGTCTCACCCTGCACATTTCTCCGATAACTCTGAAATACAGACAACTGGGAGAGCATACATGCACAGGACCTTTCTTGCTCTGAAGTCAGATCCATTGAAGACTAGGTTGGACTTGATACA...

Protein

Download Protein FASTA

552 aa · TkA03G038530|TK1151|PROTEIN

MAVVARSGRGAGGSAFSSALRSFFSYRIFVSAMFTLLFFATASVLFSSHPAHFSDNSEIQTTGRAYMHRTFLALKSDPLKTRLDLIHKQASDHIVLVNAYASYARKLKLEISKQLKTFDDMAQNFSDLGLKPTYRTALFESDGAVDEEVLRQFEKEVKDKIKVARLMIAENKESYDNQLKIQKLKDTIFAVNELLIKAKKNGAFASLIAAKSTPKSLHCLAMRLMGERIASPEKYRDEEPKSEFEDPSLYHYAIFSDNVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G038530`
TK1151 ID	TkA03G038530
OH-1004 ID	LXL04_013446
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	79.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G038530

Location Chr03:10153912-10157009 (-)

Description Similar to GAUT9: Probable galacturonosyltransferase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02350`	May be involved in pectin synthesis.	No verified direct reference in this release
`At3g25140`	Alpha-1-4-D-galacturonosyltransferase involved in homogalacturonan (HGA) synthesis, a class of pectin which plays a role in cell adhesion.	QUASIMODO1 is expressed in vascular tissue of Arabidopsis thaliana inflorescence stems, and affects homogalacturonan and xylan biosynthesis.2005 · DOI: 10.1007/s00425-005-0008-z
`At3g61130`	Involved in pectin biosynthesis.	Functional identification of an Arabidopsis pectin biosynthetic homogalacturonan galacturonosyltransferase.2006 · DOI: 10.1073/pnas.0600120103
`At5g47780`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At4g38270`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013446 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007155 cell adhesion Biological Process

GO:0010289 homogalacturonan biosynthetic process Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

KEGG gene cross-reference

ath:AT3G02350

ath:AT3G25140

ath:AT3G61130

ath:AT4G38270

ath:AT5G47780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.818

Rank 1 · TkA03G038530 · TK1151

Endoplasmic reticulum0.087

Rank 2 · TkA03G038530 · TK1151

Cell membrane0.054

Rank 3 · TkA03G038530 · TK1151

Cytoplasm0.054

Rank 4 · TkA03G038530 · TK1151

Extracellular0.053

Rank 5 · TkA03G038530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01501Glyco_transf_8141-177 aa

PF01501Glyco_transf_8252-526 aa

PF18404Glyco_transf_24361-492 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G038530	`PF01501`	Glyco_transf_8	141	177	1.4e-75	254.8
TkA03G038530	`PF01501`	Glyco_transf_8	252	526	1.4e-75	254.8
TkA03G038530	`PF18404`	Glyco_transf_24	361	492	1.4e-05	25.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FWA4`	Arabidopsis thaliana	sp\|Q9FWA4\|GAUT9_ARATH Probable galacturonosyltransferase 9	72.400%	Swiss-Prot	High
`Q9LSG3`	Arabidopsis thaliana	sp\|Q9LSG3\|GAUT8_ARATH Galacturonosyltransferase 8	69.300%	Swiss-Prot	High
`Q9LE59`	Arabidopsis thaliana	sp\|Q9LE59\|GAUT1_ARATH Polygalacturonate 4-alpha-galacturonosyltransferase	54.200%	Swiss-Prot	Medium
`Q93ZX7`	Arabidopsis thaliana	sp\|Q93ZX7\|GAUT4_ARATH Probable galacturonosyltransferase 4	52.400%	Swiss-Prot	Medium
`Q0WQD2`	Arabidopsis thaliana	sp\|Q0WQD2\|GAUT3_ARATH Probable galacturonosyltransferase 3	52.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card